KEGG   Mus musculus (mouse): 64833Help
Entry
64833             CDS       T01002                                 

Gene name
Acot10, Acate3, MT-ACT48, p48
Definition
(RefSeq) acyl-CoA thioesterase 10
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT
Motif
Other DBs
NCBI-GeneID: 64833
NCBI-ProteinID: NP_073727
MGI: 1928940
Ensembl: ENSMUSG00000047565
UniProt: Q32MW3
Position
15; 15 A2
AA seq 439 aa AA seqDB search
MKRAAMRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVQVKLREIVGISTVWRDHVQAM
EERKLLHSFLPKSQKVLPPRKIRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLD
SLGVLVCYMHNHNHSTNMSLLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTTMEV
KMKMFQLHDDETYWPVLDATFVMVAQDSENKRPAFVNPLIPENKEEEELFTQGELNKSRR
IAFSTSSLLKVAPSSEERNIIHELFLSTLDPKTISFQSRILPPKAVWMEDTKLKSLDICH
PQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQ
VCFTQGNYIQVRVHSEVFSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQR
HFKSMSTPVTLKKDYPVEP
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggcagcgatgaggctttggaccttgaacaaggggcttcttactcatggcaga
ggactatctcaaggatcccaatacaaaataagtgaacccttacacatccatcaagttcaa
gtcaagctgcgggagatagtaggtatttccacagtctggagagaccatgtacaagcaatg
gaggaaaggaagttacttcatagttttttgcctaaatcacagaaagtcctaccaccgagg
aaaataagggatagttacattgaagttctcctacctttgggtactgaccctgaactacga
gacaaatatgtgactgttcaaaatacagtaagatttggcaggattcttgaggaccttgac
agcttaggagttcttgtttgctacatgcacaaccacaatcattctaccaatatgtctctt
ttatcaatagttacagtcctggtggacaagattgatatgtgtaaacacagcttaagccct
gaacaggacattaagttcactggccatgttagctgggttggaaatacaaccatggaagtg
aagatgaaaatgttccagctgcacgatgatgagacatattggcctgttttggatgcaacc
tttgtaatggtggctcaagattctgaaaataagaggccggcatttgtaaatccactcatt
ccggaaaataaagaagaagaagagctctttacacaaggagaattgaacaagagccgaagg
attgcctttagcaccagttcattactgaaagtggctcccagttctgaggagaggaatatc
atacatgaactgtttcttagcacactggatccaaagactataagttttcagagtcgaatt
ttgcctcctaaggcagtgtggatggaggatacaaaactcaagagcttggatatttgtcac
cctcaggaacgaaatgtattcaatcggatctttggtggttttcttatgagaaaagcatat
gaacttgcatgggctactgcttgtagctttggaggttctcggccatatgtggtaacagta
gatgatatcatgtttcagaagcctgttgaagttggttcattgctctttctttcttcacag
gtatgcttcacccagggtaattacattcaagtcagagtccatagtgaagtgttctctctt
gacagtcgtgagcatatgaccaccaatgtctttcattttacattcatgtcagaaaaagaa
gtacccttgattttccctaaaacatatggagagtccatgttgtatttagatggacagcga
catttcaagtctatgagtaccccagtaaccttaaaaaaggactaccctgtggaaccctag

DBGET integrated database retrieval system