KEGG   Mus musculus (house mouse): 64898
Entry
64898             CDS       T01002                                 
Symbol
Lpin2, 2610511G02Rik
Name
(RefSeq) lipin 2
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04150  mTOR signaling pathway
mmu04936  Alcoholic liver disease
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    64898 (Lpin2)
   00564 Glycerophospholipid metabolism
    64898 (Lpin2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    64898 (Lpin2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    64898 (Lpin2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    64898 (Lpin2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     64898 (Lpin2)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Other HAD phosphatases
   64898 (Lpin2)
SSDB
Motif
Pfam: LNS2 Lipin_N Lipin_mid WRNPLPNID APP1_cat
Other DBs
NCBI-GeneID: 64898
NCBI-ProteinID: NP_075020
MGI: 1891341
Ensembl: ENSMUSG00000024052
UniProt: Q99PI5
Structure
Position
17:71490527..71556813
AA seq 893 aa
MNYVGQLAGQVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQFFKHIET
PLVKSSGNERPAQSSDVSHTLESEAVFTQSSVKKKKRRRKKCKQDNRKEEQAASPVAEDV
GDVGVSSDDEKRAQAARGSSNASLKEEDYKEPSLFHSGDNYPLSDGDWSPLETTYPQAVC
PKSDSELEVKPSESLLRSEPHMEWTWGGFPESTKVTKRERYDYHPRTATITPSENTHFRV
IPSEDSLIREVEKDATVEDTTCTIVKPKPRALCKQLSDAASTELPESPLEAPQISSLLDA
DPVPSPSAEAPSEPKPAAKDSPTKKKGVHKRSQHQGPDDIYLDDLKALEPEVAALYFPKS
DTDPGSRQWPESDTFSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEI
SKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKATV
ESWVKDKMPKKSGRWWFWRKKESMIKQLPETKEGKSEVPPANDLPSNAEEPTSARPAEND
TSSDEGSQELEESIKVDPITVETLSHCGTASYKKSLRLSSDQIAKLKLHDGPNDVVFSIT
TQYQGTCRCAGTIYLWNWNDKVIISDIDGTITKSDALGQILPQLGKDWTHQGIARLYHSI
NENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKP
EKFKIECLNDIKNLFAPSRQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERT
KGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPDLDLDDLA
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgaattatgtgggccagctggctgggcaggtgctcgtcactgtgaaggaactctacaag
ggcattaaccaagccacgttgtctggatgcatcgatgtggtcgtggtgaggcagcaggat
ggctcctaccagtgctcgccttttcacgtacgcttcgggaagctgggtgtcctgaggtcc
aaggagaaagtgattgacatagaaatcaatggcagtgctgtggatcttcacatgaaattg
ggtgataatggggaagccttctttgtagaggagactgaagaagaatatgaaaaattacct
gcttatcttgccacctcaccaattcccactgaagaccagttctttaaacatattgaaacc
cctttggtgaaatcaagtggaaatgaaaggccagctcagagttcagacgtttctcacacc
ttggaatcagaggcagttttcactcagagttctgtgaaaaagaagaaacgaaggagaaag
aagtgcaaacaggacaataggaaggaggagcaggcagcttcccctgttgcagaagatgta
ggtgatgtgggtgtgagctcagatgatgagaagagagcccaggcagcaagaggatcttca
aatgcttccttaaaggaagaggactacaaggagccttcactcttccattctggggataac
taccccttatctgatggagattggtccccattagaaaccacctaccctcaggctgtgtgc
cccaagagtgactctgagctggaggtgaagccatctgagagcctcctcagatctgagccg
cacatggagtggacgtggggcgggttcccagagtccaccaaggtcaccaaaagagaacgg
tatgactatcatccaaggacagctacgattacaccatcagagaacacacatttcagggta
attcccagtgaagacagcctcataagagaagttgaaaaggatgctactgttgaagatact
acctgtaccatagtgaaacccaaacctagagccctgtgtaagcaactgagtgatgcagcg
tctactgagcttcccgaatcacctcttgaagcacctcagatttcatcgttattagatgca
gaccctgttcccagcccatcagcagaggctccctcagaacccaaaccagctgctaaagac
tcaccaacaaaaaagaaaggtgttcacaaaagaagccagcaccagggacctgatgacatt
taccttgatgacttaaaggctcttgagcctgaagtggcggctctctatttccctaaaagt
gacacggatccaggttccaggcagtggcctgagtctgacacattctctggttctcagtcc
ccacagtctgtggggagtgcagctgcggacagtggcactgaatgcctctcagactctgcc
atggacttgcctgatgtaaccctctccctctgtggaggcctcagtgagaatggagagatt
tctaaagagaagttcatggagcatatcatcacttaccatgagtttgcagaaaaccctggc
cttatcgacaacccaaacctcgtgatccggatatataaccgttactacaactgggcgttg
gctgctcccatgatccttagcttacaggtatttcagaagagtttgcctaaggccaccgtt
gagtcctgggttaaagacaagatgccaaagaaatctggtcgatggtggttttggcggaaa
aaagaaagtatgatcaaacagttgccagagaccaaggagggaaaatctgaggtccctcca
gcaaatgacctgccttccaatgctgaggagccaaccagtgccagacctgcagagaatgac
acttctagtgacgaggggtcacaggagttggaagaaagcatcaaagttgaccccatcacc
gtagagacactgagtcactgtgggacggcctcatataagaagtctctccgactctcctcg
gaccagatagcaaaactgaagctccatgatggccccaatgacgtggtattcagtatcaca
acccagtatcagggcacctgtcggtgtgcagggaccatctacctgtggaactggaatgac
aaagtcatcatctctgacatcgacggaacaataaccaagtctgatgctttggggcagatt
ctcccacagctgggtaaagactggacgcatcagggcatagctaggctctaccattccatc
aatgagaatggctacaagtttctgtactgttctgcacgtgccatcggcatggccgacatg
acccgtggttatctgcactgggtcaatgataaggggacgatcttgcctcgaggccctctg
atgctgtctcccagcagcttgttctctgccttccacagggaagtgatagaaaagaaacca
gagaagttcaaaattgagtgtctgaatgatattaagaacttgtttgccccgtccaggcag
cccttctatgctgcctttggaaaccgtcccaacgatgtctatgcttacacacaagtcgga
gttccagactgtaggatatttactgtgaatccaaagggtgaattaatccaagagaggacc
aaagggaacaaatcatcgtatcacaggctgagtgagcttgtggaacacgtgttcccactt
ctcagtaaggagcagaattctgcctttccatgcccagagttcagctccttctgctactgg
cgagacccaatccctgacctggacctggatgacctggcttga

DBGET integrated database retrieval system