KEGG   Mus musculus (mouse): 65086
Entry
65086             CDS       T01002                                 

Symbol
Lpar3, Edg7, lpA3
Name
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    65086 (Lpar3)
   04072 Phospholipase D signaling pathway
    65086 (Lpar3)
   04151 PI3K-Akt signaling pathway
    65086 (Lpar3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65086 (Lpar3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    65086 (Lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    65086 (Lpar3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    65086 (Lpar3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 65086
NCBI-ProteinID: NP_075359
MGI: 1929469
Ensembl: ENSMUSG00000036832
Vega: OTTMUSG00000055329
UniProt: Q9EQ31 Q544B4
Position
3 H2; 3 71.03 cM
AA seq 354 aa
MNECHYDKRMDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDTSLTASLANL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLIFWTVSNLLAFFIMVAVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDM
YNTMRKMICCALQDSNTERRPSRNPSTIHSRSETGSQYLEDSISQGPVCNKNGS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaatgagtgtcactatgacaagcgcatggactttttctacaacaggagcaacacagac
acagcggacgagtggacagggacaaagcttgtgatcgtcctgtgcgtggggacgttcttc
tgcctctttatatttttttctaactccctggtcattgctgcggtgatcacaaaccggaag
ttccactttcccttctactacctgctggctaacttagctgctgcggatttcttcgccgga
atcgcttacgtgttcctgatgtttaacactggcccggtgtcgaaaacgttgaccgtcaac
cgctggttcctccgccaggggctcctagacaccagcctgactgcctccctggccaatttg
ctggttattgctgtggaaagacacatgtccatcatgaggatgagagtccacagcaacttg
accaaaaagcgggtgacgctgctcattctgctggtgtgggccatcgccatcttcatgggg
gccgtccccacgctgggatggaattgcctctgcaacatctcggcctgctcttctctggct
cccatttacagtaggagttacctcattttctggactgtgtccaacctcctggccttcttc
atcatggtggcggtatacgtacgcatctacatgtatgttaaaaggaaaaccaacgtctta
tctccacacaccagtggctccatcagccgccggagggctcccatgaagctaatgaagaca
gtgatgaccgtcttaggcgccttcgtggtgtgctggaccccgggtctggtggttctgctg
ctggacggcctgaactgcaagcagtgtaacgtgcaacacgtgaagcgctggttcctgctg
ctcgcactgctcaactccgtcatgaaccccatcatctactcgtacaaggacgaggacatg
tacaacaccatgcggaagatgatctgctgtgccctgcaggacagcaataccgagaggcgc
ccctcccgcaacccctccaccatccacagcaggagcgagacgggcagccagtacctggag
gacagcatcagccagggcccggtgtgcaataaaaacggctcctaa

DBGET integrated database retrieval system