KEGG   Mus musculus (mouse): 65114
Entry
65114             CDS       T01002                                 

Symbol
Vps35, AI647796, Mem3
Name
(RefSeq) VPS35 retromer complex component
  KO
K18468  vacuolar protein sorting-associated protein 35
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    65114 (Vps35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    65114 (Vps35)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    65114 (Vps35)
SSDB
Motif
Pfam: Vps35 FerA DUF758 Imm5 ADIP
Other DBs
NCBI-GeneID: 65114
NCBI-ProteinID: NP_075373
MGI: 1890467
Ensembl: ENSMUSG00000031696
Vega: OTTMUSG00000061416
UniProt: Q9EQH3 Q3TRJ1
Structure
Position
8:complement(85987014..86026146)
AA seq 796 aa
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSP
KSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVK
SFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSM
DFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIII
ALIDRLALFAHREDGPGIPAEIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMK
CYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
FHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPD
PEDFADEQSLVGRFIHLLRSDDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLA
FRYKENSQMDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHE
TVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKL
LKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMDPSLQVQLF
IEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNTLEHLRSR
RESPESEGPIYEGLIL
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgcctacaacacagcagtcaccccaggatgagcaggaaaaacttttggatgaagccatc
caggctgtgaaggttcagtcattccagatgaaaagatgcctggacaaaaacaagctgatg
gatgctctgaagcatgcctccaatatgcttggagagctccggacctctatgctgtcacca
aagagttactatgaactttatatggctatttctgatgaactgcactacttggaggtctac
ctgactgatgaatttgctaaaggaagaaaggtggcagatctctatgaacttgtacagtac
gcgggaaacattattccaaggctttatctcttgatcacagttggagttgtatatgtcaag
tcatttcctcaatccaggaaagatattttgaaagatttggtagaaatgtgccgtggtgtg
cagcatccgctaaggggtttgtttcttcgaaattaccttcttcagtgtactaggaacatt
ttacctgatgaaggagagccaacagatgaagaaacaactggtgatatcagtgattccatg
gattttgtactactcaactttgcagaaatgaataagctctgggtgcggatgcagcatcaa
ggacatagtcgagatagagaaaaaagagaacgagagagacaagaactgagaattttagtg
ggaacaaatttggtgcgccttagtcagttggaaggtgtaaatgtggaacgttacaaacag
attgttctaacaggcattctggagcaggttgtgaattgtagggatgctctggctcaggag
tatctcatggagtgcatcattcaggtttttcctgatgagtttcatcttcagactttgaat
ccttttcttagagcttgtgctgaattacaccaaaatgtaaatgtgaaaaacataatcatt
gctttaattgacagattagctttatttgctcatcgtgaagatggacccggaattccagct
gagattaaactttttgacatattttcacaacaggtggctacagtcatacagtccagacaa
gacatgccatcagaggatgttgtatctttacaagtctctctcattaatcttgctatgaaa
tgttaccctgatcgtgtggactacgtcgataaagttctagaaacaacagtggagatattc
aataagcttaaccttgaacatattgctaccagtagtgcagtttcaaaggagcttaccaga
cttttgaagatacctgttgatacttacaacaatatcttaacagtattaaagttaaagcat
ttccacccactttttgagtactttgactacgagtccagaaagagcatgagctgttatgtg
cttagtaatgttctggattataacacagaaatcgtctctcaggaccaggtagattccata
atgaatttggtgtccacattgattcaggatcagccagaccaacctgtagaagaccctgat
ccagaagacttcgctgatgaacagagccttgttggccgatttattcatctgctacgttct
gatgatcctgaccagcagtatttgattttgaatacggcacgaaaacattttggggctggt
ggaaatcagcggattcgcttcacactgccacctttggtatttgcagcttaccagttggct
tttcgatacaaagagaattcccaaatggatgacaagtgggaaaagaaatgccagaagata
ttttcatttgctcaccagactatcagtgctttgattaaagctgagctggctgaattacca
ctgagactttttcttcaaggagcattagctgctggagaaattggctttgaaaatcatgaa
acagtagcatatgaatttatgtcccaggcattttctctatatgaagatgaaatcagtgat
tctaaagcacagctggctgctatcaccttgatcatcggtacttttgagaggatgaaatgc
ttcagtgaagagaatcatgaacccttgagaactcagtgtgcacttgctgcatcaaaactt
ctgaaaaaaccagatcaaggccgagccgtgagcacatgtgcgcatctcttttggtctggc
cgaaacacagacaaaaatggggaagagcttcatggaggtaaaagggtcatggagtgccta
aagaaggcactaaaaatagcaaatcagtgcatggacccctctctacaagttcagctcttt
atagagattctgaacaggtacatctatttctatgaaaaagaaaatgatgcggtaaccatt
caagtcttgaaccaacttattcaaaagattcgagaagatctcccaaatcttgagtccagt
gaagaaacagaacaaataaacaagcattttcacaacacattggagcacttgcgctcaaga
cgggaatcaccagagtctgaggggccaatctatgaaggtctcatcctttaa

DBGET integrated database retrieval system