KEGG   Mus musculus (house mouse): 65116
Entry
65116             CDS       T01002                                 
Symbol
Prrg2, 1600014G02Rik, 2510041M06Rik, N4WBP1
Name
(RefSeq) proline-rich Gla (G-carboxyglutamic acid) polypeptide 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Gla DUF3325
Other DBs
NCBI-GeneID: 65116
NCBI-ProteinID: NP_075375
MGI: 1929596
Ensembl: ENSMUSG00000007837
UniProt: Q8R182
Position
7:complement(44703008..44711950)
AA seq 198 aa
MRGRPSLLLVYMGLATCLDTSPHREQNQVLDIFLDAPEAQSFLVGRRRFPRANHWDLELL
TPGNLERECLEERCSWEEAREYFEDNTLTERFWESYTYNGKGGRGRVDVAGLAVGLTSGI
LLIVLAGLGAFWYLHYRRRRLRGQESCLQETGLIIPLSPQTPQSPPLPPGLPTYEQALAA
SGVHDAPPPPYSSLRRPH
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaggggccgtccttccctgctcttagtctatatgggattggccacctgcctggacacc
tcacctcacagagagcaaaaccaagttcttgacatcttcctggatgccccagaggcccag
agtttcttagttggccgcaggcgttttcctcgtgctaaccactgggacctggagttgctg
acccctgggaacctggaacgggagtgtctggaggagaggtgctcctgggaggaggcccgg
gagtactttgaggacaacacactgacggagcgcttctgggaaagctatacgtacaatggc
aagggagggcgtggacgggtggatgttgcaggcctggcggtgggactgacctctgggatc
ctcctcattgtcttggccggcttgggagccttttggtatctgcattatcgacggcgccgc
ctcagaggccaggagtcctgtctgcaagagaccgggctcatcatccccttgagtcctcag
acgcctcaatctccacccttgcccccaggccttcccacctatgagcaggctttagcagcc
tccggggtgcacgacgcacctccgcccccttactccagcctcagaaggcctcactga

DBGET integrated database retrieval system