KEGG   Mus musculus (mouse): 65962
Entry
65962             CDS       T01002                                 

Gene name
Slc9a3r2, 0610011L07Rik, 1200011K07Rik, 2010007A20Rik, E3k, E3karp, NHERF-2, Nher, Nherf2, Oct, Octs2, S, Si, Sip-1, Sip1, Sr, Sryip1, Tka-, Tka-1
Definition
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
  KO
K13358  sodium/hydrogen exchange regulatory cofactor NHE-RF2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    65962 (Slc9a3r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    65962 (Slc9a3r2)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   65962 (Slc9a3r2)
SSDB
Motif
Pfam: PDZ EBP50_C PDZ_6 PDZ_2 DUF5994 GRASP55_65 DUF6288
Other DBs
NCBI-GeneID: 65962
NCBI-ProteinID: NP_075542
MGI: 1890662
Ensembl: ENSMUSG00000002504
UniProt: Q9JHL1 A0A0R4IZX2
Position
17; 17 A3.3
AA seq 337 aa
MAALESLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWE
PKPDWACSGSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVD
PGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRLR
VIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDNEDGSTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggccgcgctggaatcgctgcggccccgcttgtgtcgcctggtgcgcggagagcaaggg
tacggctttcacctgcatggcgagaaaggccgccgtggccagttcatccggcgcgtggag
ccaggctccccagccgaggcggccgcgctgcgcgccggggaccgcctggttgaggtcaac
ggcgtcaacgtagagggcgagacgcatcaccaggtggtacagaggatcaaggctgtggag
gggcagacccagctgcttgtggtggacaaggagaccgatgaggagctctgccggcggcaa
ctgacctgcactgaggagatggcccatcgagggcttcccccagcccacaacccctgggag
ccaaagccggactgggcatgctcgggcagccttggctcggacactggccagaaggatgtc
aatgggcccccaagagagctgcgtccccggctctgccacttgcgaaggggaccccagggc
tacgggttcaacctgcatagtgacaagtcccggcctggccagtacatccgctctgtggac
cctggctctcctgcttctcactctggcctccgtgcccaggatcggctcattgaggtgaat
gggcagaacgtggaggggctgcgacatgccgaggttgtcgccagaatcaaggcacaggag
gacgaggcccggctgctggtagtcgatcctgagactgatgaacacttcaagcggttgagg
gtcatacccactgaggaacatgtagaaggtccactgccatcaccagtcacgaacgggacc
agtcctgcccagctcaatggtggctctgtgtgctcatcccgaagtgacctgccaggctca
gagaaggacaatgaggatggcagtacctggaagcgagaccccttccaggaaagtggcctc
cacctgagtcccacagcagctgaggccaaggagaaggctcgagctactcgggtcaacaag
cgggcaccacagatggactggaaccggaagcgagagatcttcagcaacttctga

DBGET integrated database retrieval system