KEGG   Mus musculus (mouse): 65967
Entry
65967             CDS       T01002                                 

Symbol
Eefsec, Selb, mSelB, sec
Name
(RefSeq) eukaryotic elongation factor, selenocysteine-tRNA-specific
  KO
K03833  selenocysteine-specific elongation factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    65967 (Eefsec)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   65967 (Eefsec)
 Prokaryotic type
   65967 (Eefsec)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 MMR_HSR1 SRPRB cobW FliS_cochap Gtr1_RagA RIBIOP_C RsgA_GTPase
Other DBs
NCBI-GeneID: 65967
NCBI-ProteinID: NP_075547
MGI: 2137092
Ensembl: ENSMUSG00000033216
Vega: OTTMUSG00000057348
UniProt: Q9JHW4 Q3UGH6
Position
6; 6 D1
AA seq 583 aa
MAGRRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFVVPL
PGAEPGSSDTLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIG
QIACQKLVVVLNKIDLLAEGKRQAAIDKMTKKMQKTLENTKFRGAPIIPVAAKPGGPEAP
ETEAPQGISELIELLKSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGTISLGD
SVEIPALKVVKKVKSMQMFHTPVTSAMQGDRLGICVTQFDPKLLERGLVCAPESLHTVHA
ALISVEKIPYFRGPLQTKAKFHITVGHETVMGRTLFFSPAPDSFDLEPVLDSFDLSREYL
FQEQYLCKDSMPTATEGDDEADPKAGHAPGGHCPRQQWALVEFEKPVTCPRLCLVIGSRL
DADIHTNTCRLAFHGVLLQGLEDKNYIESFLPALRVYKLKHKHGLVERVMDDYSVIGRSL
FKKETNIQLFVGLKVQLSTGEQGIIDSAFGQSGKFKIHIPGGLSPESKKILTPTLKKRSR
AGRGETTKPEEGTERPEPIQPVTLNLSFKRYVFDTQKRMVQTP
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggccggccggcgggtaaatgtgaatgtgggcgtgctgggtcacatcgacagtggcaaa
acagcgctggcgcgcgcgctgagcaccacggcctccactgctgccttcgacaagcagccg
cagagccgcgagcgcggcataacgctcgacctgggcttctcctgttttgtcgtgccgctg
ccgggggcagaacccggttctagcgacacgctgctgcaggtcacactggtcgactgcccc
gggcacgcctccctcatccggaccatcattggcggtgcccagatcattgatttgatgatg
ctcgtgattgatgtgaccaagggaatgcagacacagtccgcagagtgccttgtgattggc
cagatcgcctgccagaagctggttgtggtgctgaacaaaatagacctgttagcagaaggg
aagagacaggcagcgattgacaaaatgaccaagaaaatgcagaagactcttgagaacacc
aaattccggggtgcaccgattattcccgtggcagccaaacctgggggaccagaagcccct
gaaactgaagctccacagggcatctcagaactcattgagctcctgaagtcccagatttcc
atcccaacgagagacccctctggaccattccttatgtctgtggaccactgcttctccatc
aagggtcaaggcaccgtgatgactgggactatcctctcaggcactatcagccttggggac
agtgtggagatccctgccctcaaggtggtgaagaaagtgaagtccatgcagatgttccat
acacccgtcacctctgccatgcagggggaccgactgggcatctgtgtcacccagtttgac
cccaagctgttggagcgtgggctggtatgtgcacccgagtctctgcacactgttcacgca
gccctcatctctgtggagaagatcccttacttccgaggacccctgcagaccaaggccaag
ttccatatcaccgttggccatgagacagtcatgggtcgcacgctgttcttcagccctgct
cctgacagctttgacttggagcccgtgctagattccttcgacctttcccgagagtacctc
ttccaagagcagtacctgtgcaaggattccatgcccacagccacagaaggtgatgacgag
gcggaccccaaagccggccacgccccagggggccactgcccccggcagcagtgggccctg
gtagagtttgagaagccagtcacctgcccccgactctgcttggtgattggctccagacta
gatgccgacattcacaccaacacatgccggctggccttccatggtgtcttgctgcaaggg
ctggaggacaagaactacattgagagcttcctgccagcactgagggtttacaagctgaag
cacaagcatggccttgtggagcgggtaatggatgactacagcgtgattggacgttccctg
ttcaaaaaggagaccaacatccagctctttgtggggcttaaggtgcagctgtccacaggg
gaacagggtatcatcgacagtgccttcggccaaagtggcaagttcaagatccacatccct
ggtggcctcagccctgagtccaagaagatcctgacacctacactcaagaagcggagccga
gccggccgtggagagaccaccaagccagaggagggcactgaacggccagagcccatccag
cctgtgacactcaacctgtctttcaagcgctatgtctttgacacccagaagcgcatggta
cagactccctga

DBGET integrated database retrieval system