KEGG   Mus musculus (house mouse): 65972
Entry
65972             CDS       T01002                                 
Symbol
Ifi30, GILT, IP30
Name
(RefSeq) interferon gamma inducible protein 30
  KO
K08059  interferon, gamma-inducible protein 30
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    65972 (Ifi30)
SSDB
Motif
Pfam: GILT
Other DBs
NCBI-GeneID: 65972
NCBI-ProteinID: NP_075552
MGI: 2137648
Ensembl: ENSMUSG00000031838
Position
8:complement(71215418..71219307)
AA seq 248 aa
MSWSPILPFLSLLLLLFPLEVPRAATASLSQASSEGTTTCKAHDVCLLGPRPLPPSPPVR
VSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELE
CRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKR
GTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTEKPDICSSIAD
SPRKVCYK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcctggtctccgatcctaccatttttgtcccttctgcttctgctgttcccactcgag
gttcccagagcagccactgcgtccctttcgcaagcatcctccgaaggcacaaccacctgc
aaggcccacgatgtgtgcctcttggggccacgcccattgcccccttcaccacctgtcaga
gtcagcctgtattatgagtccctgtgtggagcttgtcgctacttcctcgtccgggatttg
ttcccaacctggctgatggtgatggaaatcatgaacatcaccctggtgccctacgggaat
gcacaggagagaaatgtcagcggtacgtgggagttcacgtgccagcacggggagctggag
tgtagactgaacatggtggaggcctgtctgctggataagctggaaaaggaggcagcgttc
ctaaccatcgtctgtatggaggagatggatgatatggagaagaaactgggaccgtgcctg
caggtgtatgctcctgaggtgtcaccagagagtatcatggagtgcgccacaggaaaacgg
ggcacacagctcatgcatgagaatgcccagctcacagatgccctacacccaccccacgag
tatgtgccctgggtgctggtcaatgagaaacctttgaaggaccccagcgagctcctgagc
atagtctgtcagctgtaccagggaacggagaagccagacatctgctcctccattgccgac
tcccccaggaaggtctgctataagtaa

DBGET integrated database retrieval system