KEGG   Mus musculus (mouse): 65973Help
Entry
65973             CDS       T01002                                 

Gene name
Asph, 2310005F16Rik, 3110001L23Rik, AI848629, AW261690, AW561901, BAH, C79816, cI-37
Definition
(RefSeq) aspartate-beta-hydroxylase
  KO
K00476  aspartate beta-hydroxylase [EC:1.14.11.16]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    65973 (Asph)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.16  peptide-aspartate beta-dioxygenase
     65973 (Asph)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp-B-Hydro_N Asp_Arg_Hydrox TPR_16 TPR_14 TPR_19 TPR_6 TPR_2 TPR_11 TPR_8 SNAP ATG27 TPR_15 ANAPC3 Coatomer_E DUF2299 YfiO LUC7
Motif
Other DBs
NCBI-GeneID: 65973
NCBI-ProteinID: NP_075553
MGI: 1914186
Ensembl: ENSMUSG00000028207
Vega: OTTMUSG00000004455
UniProt: Q8BSY0
Position
4; 4 A1
AA seq 741 aa AA seqDB search
MAPRKNAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGARREAKHGGHKNGRRGGISG
GSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLGLKE
RSPSERTFPPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQSLLQESVHTDHDLEADGL
AGEPQPEVEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDTASQNHPNDMEEMTNEQEN
SDPSEAVTDAGVLLPHAEEVRHQDYDEPVYEPSEHEGVAISDNTIDDSSIISEEINVASV
EEQQDTPPVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAVNAFEELVRKYPQSPRA
RYGKAQCEDDLAEKQRSNEVLRRAIETYQEAADLPDAPTDLVKLSLKRRSERQQFLGHMR
GSLLTLQRLVQLFPSDTTLKNDLGVGYLLLGDNDSAKKVYEEVLNVTPNDGFAKVHYGFI
LKAQNKISESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFA
SVWQRSLYNVNGLKAQPWWTPRETGYTELVKSLERNWKLIRDEGLMVMDKAKGLFLPEDE
NLREKGDWSQFTLWQQGRKNENACKGAPKTCALLEKFSETTGCRRGQIKYSIMHPGTHVW
PHTGPTNCRLRMHLGLVIPKEGCKIRCANETRTWEEGKVLIFDDSFEHEVWQDASSFRLI
FIVDVWHPELTPQQRRSLPAI
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcaagaacgccaagggcggcggcggcaacagcagcagcagcggcagcggc
agcggctcgggcagcggtagcccgagcacgggtagcagcggtagcagcagtagccccggg
gctcggagagaggcaaagcacggaggacacaagaatgggagaagaggagggatttcagga
gggtcctttttcacatggttcatggtcattgcattgctcggcgtctggacatctgtggct
gtcgtgtggtttgacttggtcgattatgaagaagttctaggaaaactaggagtctatgat
gcggatggcgatggagactttgatgtggatgatgccaaagttttattaggccttaaagaa
agatctccttctgagaggacatttccaccggaggaggaggcagagactcacgctgagctg
gaggagcaggcccctgagggggcagacatccagaatgttgaagatgaagtaaaggaacaa
attcagtcccttcttcaggaatcagtacacacagaccatgaccttgaagcagatgggctg
gcaggagaaccacagccggaggttgaggacttcctcacagtgaccgacagtgatgacaga
tttgaggacctggaacccgggacagttcatgaagaaatcgaggatacttaccatgtggaa
gacacagcatcgcagaaccatccaaatgacatggaagagatgacgaatgagcaggaaaat
tcagatcccagtgaagcagtgacagatgcaggtgtgctgctgccccatgcagaggaagta
agacaccaagactatgatgaaccagtatatgaaccctcagagcatgaaggggtcgcgatt
tcagataacaccatagatgattccagcataatctcagaagaaataaatgtcgcctctgtt
gaagaacagcaagacacaccaccagttaagaagaagaagcctaaacttctgaacaaattt
gataagacaattaaggctgagctggatgctgcagaaaagctccggaaaaggggtaaaatt
gaggaagcagtgaacgcatttgaagaactggttcgaaagtaccctcagagcccacgagca
agatatggcaaagcgcagtgtgaagatgacttggcagagaagcagagaagcaatgaggtt
ctgcgcagggccatcgagacctaccaggaggcagccgacctgcctgatgcccctacagac
ctggtgaagctgagcttgaagcgaaggtcggaacggcagcagtttctaggtcacatgaga
ggttctctacttaccctccagagactagttcaactgttccctagtgatactaccttaaaa
aacgaccttggcgtaggatacctcttgttgggagacaacgacagtgccaagaaggtttac
gaagaggtgctaaatgtgacaccaaatgatggcttcgctaaagtgcattacggcttcatc
ctgaaggcacagaacaagatatctgagagcattccctacttaaaggaaggaatcgaatct
ggggaccctggcacggatgatggccggttttacttccacttgggggatgccatgcagagg
gtcgggaacaaagaggcatataagtggtatgaacttgggcacaagagaggacattttgcc
tctgtctggcagcgttccctctacaatgtgaatggtctgaaggctcagccgtggtggaca
cccagggagactggctacacagagctagtgaagtctttagagagaaactggaagttaatc
cgtgatgaaggcctcatggtgatggataaagccaagggtctcttcctgcctgaggacgaa
aaccttcgggagaagggcgactggagccagttcacactgtggcagcaaggaaggaagaat
gagaatgcctgtaaaggagcgcctaagacctgtgctttactagaaaagttttccgaaaca
acaggatgcagaagaggacagatcaaatactccatcatgcaccctggaactcatgtgtgg
ccgcatacaggacccacaaactgcaggctccgaatgcatctggggttagtgatccccaag
gaaggctgcaagatccggtgtgccaatgagaccaggacgtgggaagaaggcaaggtgctc
atctttgatgactcttttgagcacgaggtttggcaggatgcctcgtctttccggctgata
ttcatcgtggatgtgtggcaccccgagctgacccctcagcagagacgcagccttcccgca
atttga

DBGET integrated database retrieval system