KEGG   Mus musculus (mouse): 66042Help
Entry
66042             CDS       T01002                                 

Gene name
Sostdc1, 0610006G05Rik, Sostl, USAG-1, Wise, ectodin
Definition
(RefSeq) sclerostin domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Sclerostin DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 66042
NCBI-ProteinID: NP_079588
MGI: 1913292
Ensembl: ENSMUSG00000036169
UniProt: Q9CQN4
Position
12; 12 A3
AA seq 206 aa AA seqDB search
MLPPAIHLSLIPLLCILMRNCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHF
SSTGLDRNSRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGT
KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFE
SVSPAKPAQHHRERKRASKSSKHSLS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctcctgccattcatctctctctcattcccctgctctgcatcctgatgagaaac
tgtttggcttttaaaaatgatgccacagaaatcctttattcacatgtggttaaacctgtc
ccggcacaccccagcagcaacagcaccctgaatcaagccaggaatggaggcaggcatttc
agtagcactggactggatcgaaacagtcgagttcaagtgggctgcagggaactgcggtcc
accaaatacatttcggacggccagtgcaccagcatcagccctctgaaggagctggtgtgc
gcgggcgagtgcttgcccctgccggtgcttcccaactggatcggaggaggctatggaaca
aagtactggagccggaggagctctcaggagtggcggtgtgtcaacgacaagacgcgcacc
cagaggatccagctgcagtgtcaggacggcagcacgcgcacctacaaaatcaccgtggtc
acggcgtgcaagtgcaagaggtacacccgtcagcacaacgagtccagccacaactttgaa
agcgtgtcgcccgccaagcccgcccagcaccacagagagcggaagagagccagcaaatcc
agcaagcacagtctgagctag

DBGET integrated database retrieval system