KEGG   Mus musculus (mouse): 66046Help
Entry
66046             CDS       T01002                                 

Gene name
Ndufb5, 0610007D05Rik, AU015782, CI-SGDH, SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66046 (Ndufb5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66046 (Ndufb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    66046 (Ndufb5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    66046 (Ndufb5)
   05012 Parkinson disease
    66046 (Ndufb5)
   05016 Huntington disease
    66046 (Ndufb5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    66046 (Ndufb5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B5 FRG1
Motif
Other DBs
NCBI-GeneID: 66046
NCBI-ProteinID: NP_079592
MGI: 1913296
Ensembl: ENSMUSG00000027673
Vega: OTTMUSG00000028013
UniProt: Q9CQH3
Structure
PDB: 

Position
3; 3 A3
AA seq 189 aa AA seqDB search
MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPS
LYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRW
IARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFID
HSPKATPDN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatgagcctgctgcagcgggcttcggtctccgcgctgacagcgctgtcttgc
cgccgcgctggtcctagactcggagtcggaagttttctcacgcggagctttccgaagact
gtcgctcctgtgcggcacagtggggaccatggcaagagactgtttgtcgtcaagccttct
ttatactatgacgctcgcttcttgaggttaatgaaattctaccttatgttgactgggatc
ccagttataattggcataacactggtgaacatatttattggtgaagccgagcttgcagaa
atcccagaaggctacatccctgaacactgggagtattacaagcatccgatatcaagatgg
atcgcccggaatttctatgatggccctgaaaagaactacgagaaaaccctggctatcctc
cagattgaatctgaaaaggctgagttacggttaaaggagcaggaagttcgaaggctgatg
cgtgcccgaggtgatggaccctggtatcaatttccaacccctgaaaaggagttcattgat
cattctccaaaggcaactcctgacaactga

DBGET integrated database retrieval system