KEGG   Mus musculus (house mouse): 66050
Entry
66050             CDS       T01002                                 
Symbol
0610009B22Rik
Name
(RefSeq) RIKEN cDNA 0610009B22 gene
  KO
K20301  trafficking protein particle complex subunit 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66050 (0610009B22Rik)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    66050 (0610009B22Rik)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    66050 (0610009B22Rik)
SSDB
Motif
Pfam: Sedlin_N Sybindin DUF4984
Other DBs
NCBI-GeneID: 66050
NCBI-ProteinID: NP_079595
MGI: 1913300
Ensembl: ENSMUSG00000007777
UniProt: Q9CQP2 Q8R3W2
Structure
Position
11:complement(51576207..51579933)
AA seq 140 aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDEHRHLNQFIAHAALDLVDENMWLSNNMY
LKTVDKFNEWFVSAFVTAGHMRLIMLHDVRHEDGIKNFFTDVYDLYIKFAMNPFYEPNSP
IRSSAFERKVQFLGKKHLLN
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtctgggagcttctacttcgtaattgttggccaccatgataatccggtttttgaaatg
gaatttttgccagctgggaaagcagaatctaaagatgaacaccgtcatctgaaccagttc
atagctcatgctgctctggacctcgtcgacgaaaacatgtggctctccaacaacatgtac
ttaaaaactgtggacaaattcaatgagtggttcgtctcggcgttcgtcacggctgggcac
atgcggctcatcatgctgcatgacgtgaggcacgaggatggcatcaagaacttcttcact
gacgtctacgacttatacatcaaatttgccatgaatcccttttatgaacccaattctcct
attcgatcgagtgcattcgaaagaaaagttcagtttcttgggaagaaacatcttttaaac
taa

DBGET integrated database retrieval system