KEGG   Mus musculus (house mouse): 66052
Entry
66052             CDS       T01002                                 
Symbol
Sdhc, 0610010E03Rik, AI316496, AU019277
Name
(RefSeq) succinate dehydrogenase complex, subunit C, integral membrane protein
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    66052 (Sdhc)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66052 (Sdhc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66052 (Sdhc)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    66052 (Sdhc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66052 (Sdhc)
   05012 Parkinson disease
    66052 (Sdhc)
   05014 Amyotrophic lateral sclerosis
    66052 (Sdhc)
   05016 Huntington disease
    66052 (Sdhc)
   05020 Prion disease
    66052 (Sdhc)
   05022 Pathways of neurodegeneration - multiple diseases
    66052 (Sdhc)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66052 (Sdhc)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66052 (Sdhc)
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 66052
NCBI-ProteinID: NP_079597
MGI: 1913302
Ensembl: ENSMUSG00000058076
UniProt: Q9CZB0
Position
1:complement(170956726..170978209)
AA seq 169 aa
MAAFLLRHVSRHCLRAHLNAQLCIRNAAPLGTTAKEEMERFWKKNTSSNRPLSPHLTIYK
WSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKSLCLGPTLIYSAKFVL
VFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgcgttcttgctgagacatgtcagccgtcactgcctccgagcccacctgaatgct
cagctttgtatcagaaatgctgctcctttgggaaccacagctaaggaggagatggagcgg
ttctggaagaagaacacgagttcaaaccgtcctctgtctccccatttgactatctacaaa
tggtctcttcctatggcactgtccgtttgccaccgaggctctggaatagccttgagtgga
ggggtctctctttttggcctgtcggcactgctgcttcctgggaactttgagtcatatttg
atgtttgtgaagtccctgtgtttggggccaacactgatctactcggctaagtttgtgctt
gtcttcccgctcatgtaccactcactgaatgggatccgacacttgctatgggacctagga
aaaggcctggcaataccccaggtctggctgtctggagtggcggtcgtggttcttgctgtg
ttgtcctctggcgggctggccgccctgtga

DBGET integrated database retrieval system