KEGG   Mus musculus (mouse): 66052
Entry
66052             CDS       T01002                                 

Gene name
Sdhc, 0610010E03Rik, AI316496, AU019277
Definition
(RefSeq) succinate dehydrogenase complex, subunit C, integral membrane protein
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    66052 (Sdhc)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66052 (Sdhc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66052 (Sdhc)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66052 (Sdhc)
   05012 Parkinson disease
    66052 (Sdhc)
   05014 Amyotrophic lateral sclerosis
    66052 (Sdhc)
   05016 Huntington disease
    66052 (Sdhc)
   05020 Prion disease
    66052 (Sdhc)
   05022 Pathways of neurodegeneration - multiple diseases
    66052 (Sdhc)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66052 (Sdhc)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66052 (Sdhc)
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 66052
NCBI-ProteinID: NP_079597
MGI: 1913302
Ensembl: ENSMUSG00000058076
Vega: OTTMUSG00000021661
UniProt: Q9CZB0
Position
1; 1 H3
AA seq 169 aa
MAAFLLRHVSRHCLRAHLNAQLCIRNAAPLGTTAKEEMERFWKKNTSSNRPLSPHLTIYK
WSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKSLCLGPTLIYSAKFVL
VFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgcgttcttgctgagacatgtcagccgtcactgcctccgagcccacctgaatgct
cagctttgtatcagaaatgctgctcctttgggaaccacagctaaggaggagatggagcgg
ttctggaagaagaacacgagttcaaaccgtcctctgtctccccatttgactatctacaaa
tggtctcttcctatggcactgtccgtttgccaccgaggctctggaatagccttgagtgga
ggggtctctctttttggcctgtcggcactgctgcttcctgggaactttgagtcatatttg
atgtttgtgaagtccctgtgtttggggccaacactgatctactcggctaagtttgtgctt
gtcttcccgctcatgtaccactcactgaatgggatccgacacttgctatgggacctagga
aaaggcctggcaataccccaggtctggctgtctggagtggcggtcgtggttcttgctgtg
ttgtcctctggcgggctggccgccctgtga

KEGG   Mus musculus (mouse): 66925
Entry
66925             CDS       T01002                                 

Gene name
Sdhd, 3110001M13Rik, AVLL5809, C78570, PRO19626
Definition
(RefSeq) succinate dehydrogenase complex, subunit D, integral membrane protein
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    66925 (Sdhd)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66925 (Sdhd)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66925 (Sdhd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66925 (Sdhd)
   05012 Parkinson disease
    66925 (Sdhd)
   05014 Amyotrophic lateral sclerosis
    66925 (Sdhd)
   05016 Huntington disease
    66925 (Sdhd)
   05020 Prion disease
    66925 (Sdhd)
   05022 Pathways of neurodegeneration - multiple diseases
    66925 (Sdhd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66925 (Sdhd)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66925 (Sdhd)
SSDB
Motif
Pfam: CybS
Other DBs
NCBI-GeneID: 66925
NCBI-ProteinID: NP_080124
MGI: 1914175
Ensembl: ENSMUSG00000000171
Vega: OTTMUSG00000063072
UniProt: Q9CXV1
Position
9; 9 A5.3
AA seq 159 aa
MAVLLKLGVLCSGQGARALLLRSRVVRPAYVSAFLQDQPTQGRCGTQHIHLSPSHHSGSK
AASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGLGQVVTDYVHGDTL
PKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcggttctcttaaagctgggcgttctctgcagtggccaaggagctcgagctctccta
ctccgaagccgggtggtcagacccgcttatgtgtcagcatttctccaggaccagcctacc
caaggacggtgtggtacccagcacattcacctgtcaccaagccaccactctggttccaag
gctgcatctctccactggaccagtgagagggttgtcagtgttctgctcttggggctgatc
cctgctgggtacttgaatccctgctctgtggtggactactctctggctgcagccctcacc
ctgcacagtcactggggccttggacaagtggttaccgactacgttcatggggacaccctg
ccgaaggctgccagggcaggcctcttggcactctcagctttgacctttgctgggctttgc
tacttcaattaccacgatgtcggcatctgcagagcggttgccatgctgtggaagctctga

KEGG   Mus musculus (mouse): 66945
Entry
66945             CDS       T01002                                 

Gene name
Sdha, 1500032O14Rik, 2310034D06Rik, 4921513A11, C81073, F, FP, SDH, SDH2, SDHF
Definition
(RefSeq) succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    66945 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66945 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66945 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66945 (Sdha)
   05012 Parkinson disease
    66945 (Sdha)
   05014 Amyotrophic lateral sclerosis
    66945 (Sdha)
   05016 Huntington disease
    66945 (Sdha)
   05020 Prion disease
    66945 (Sdha)
   05022 Pathways of neurodegeneration - multiple diseases
    66945 (Sdha)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66945 (Sdha)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66945 (Sdha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     66945 (Sdha)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Other DBs
NCBI-GeneID: 66945
NCBI-ProteinID: NP_075770
MGI: 1914195
Ensembl: ENSMUSG00000021577
Vega: OTTMUSG00000030724
UniProt: Q8K2B3
Position
13; 13 C1
AA seq 664 aa
MAGVGAVSRLLRGRRLALTGAWPGTLQKQTCGFHFSVGENKKASAKVSDAISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPSIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKIS
QLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
VDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggccggggttggcgcagtttcgaggcttcttcgcgggcggcgcttggcgttaactggg
gcgtggccaggaacactccaaaaacagacctgcggctttcacttctctgttggtgagaac
aagaaggcatcagctaaagtttcagatgcaatttctactcaatacccagtggtggatcat
gaatttgatgctgtggttgtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatactgcatgccttacaaagctctttcctacccgatcacatact
gttgcagcacagggaggtatcaatgctgctctggggaacatggaagaggacaactggaga
tggcatttctatgacactgtgaaaggctccgactggctgggggatcaggatgccatccat
tacatgacagagcaagctcctgcctctgtggttgagctagaaaattatggtatgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
gggaaaggcgggcaggctcatcggtgttgctgtgtggctgatcggacaggccactcactc
ttacacacgttgtatggaagatctctgcgatatgacaccagttattttgtggaatatttt
gcactggatcttctgatggaaaatggggagtgccgtggtgtcattgcactgtgcatagaa
gatgggtccatacaccgaataagagcaaaaaacactgttattgctactgggggctacggg
cgaacctacttcagctgtacatctgcccataccagcacaggggacggcacagccatggtc
actagggctggtttgccttgccaggacttagaatttgttcagttccaccccacaggtata
tacggtgctggctgcctcatcacagaagggtgtcgtggagagggggggattctcatcaac
agtcaaggtgaaaggttcatggagagatacgcacctgttgccaaggacctggcatcaaga
gatgttgtgtctcgatccatgactcttgagatccgtgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagttgcatcatctgcctcctgagcaactggccacacgtcta
cccggaatttcagagacggccatgatcttcgctggtgtggatgtcactaaggagcccatc
ccagtcctccccactgtgcattacaacatgggtgggattcccactaactacaagggacag
gtgctgaagcatgtgaatggccaggatcagattgtgcctggtctgtatgcctgtggggag
gctgcctgcgcctcagtgcatggtgccaaccggcttggagcaaattctctcttggacctt
gtagtctttggcagagcctgtgccctgagcattgcagaatcttgcaggcctggagataaa
gttccttcaattaaggcaaatgctggagaagaatcggttatgaatcttgacaagttgaga
tttgccgatggaagtataagaacatcagaactacgcctaaacatgcagaagtcgatgcag
aaccatgctgcagtgttccgtgtggggagtgtattgcaagaaggctgtgaaaaaatcagt
cagctctatggagacctaaagcatctaaagacattcgacaggggaatggtttggaacaca
gacctggtggagaccctggagctgcagaatctgatgctgtgcgcactgcagaccatatat
ggtgcagaagctcggaaggagtcccggggagcccatgccagggaagattacaaagtgcgg
gtcgatgagtatgattactccaagcccatccagggacagcagaagaagccgtttggggaa
cactggaggaagcacaccctctcatatgtggacatcaagactggcaaggttactttggag
tacagacctgttatcgacaagaccttgaatgaggctgactgtgccaccgtacctcctgct
atccgctcctactga

KEGG   Mus musculus (mouse): 67680
Entry
67680             CDS       T01002                                 

Gene name
Sdhb, 0710008N11Rik
Definition
(RefSeq) succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    67680 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67680 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67680 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67680 (Sdhb)
   05012 Parkinson disease
    67680 (Sdhb)
   05014 Amyotrophic lateral sclerosis
    67680 (Sdhb)
   05016 Huntington disease
    67680 (Sdhb)
   05020 Prion disease
    67680 (Sdhb)
   05022 Pathways of neurodegeneration - multiple diseases
    67680 (Sdhb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67680 (Sdhb)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67680 (Sdhb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     67680 (Sdhb)
SSDB
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Other DBs
NCBI-GeneID: 67680
NCBI-ProteinID: NP_075863
MGI: 1914930
Ensembl: ENSMUSG00000009863
Vega: OTTMUSG00000010087
UniProt: Q9CQA3
Position
4; 4 D3
AA seq 282 aa
MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRM
QTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRID
TDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPF
SVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcggcgacggtcggggtctccttgaagcgcggcttcccggctgccgttctcggcaga
gtcggcctgcagtttcaggcctgtcgaggggcacagacagctgctgctgcagctcccaga
atcaaaaaatttgccatttaccgatgggacccagacaagactggagataaacctcgaatg
cagacgtacgaggtggatctgaataagtgcggacctatggtgttggatgctttaatcaag
atcaagaatgaagtggattctactttaaccttccgaagatcttgtagagaaggcatctgt
ggctcttgcgccatgaacatcaacggaggcaatactctggcgtgcacacgcaggatcgac
acggacctcagcaaagtctccaaaatctaccctcttccacatatgtatgtgatcaaggat
ctagtccctgatttgagtaacttctacgcacaatacaaatccattgagccttatctgaag
aagaaggatgagtcccaggagggcaagcaacagtatctgcagtccatcgaggaccgggag
aagctggacgggctgtacgagtgcatcctgtgtgcctgctgcagcaccagctgccccagc
tactggtggaacggagacaagtacctggggcctgcagttctcatgcaggcctatcgctgg
atgatcgactccagagacgacttcacagaggaacgcctggccaagctgcaggaccccttc
tctgtctaccgctgccacaccatcatgaactgcacacagacctgccccaagggtctgaat
ccggggaaagcgattgcggaaatcaagaagatgatggcgacctacaaggagaagcgagca
ttggcttaa

DBGET integrated database retrieval system