KEGG   Mus musculus (mouse): 66055
Entry
66055             CDS       T01002                                 

Gene name
Sf3b6, 0610009D07Rik, 6030419K15Rik, AV001342, Sf3b1, Sf3b14
Definition
(RefSeq) splicing factor 3B, subunit 6
  KO
K12833  pre-mRNA branch site protein p14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    66055 (Sf3b6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    66055 (Sf3b6)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    66055 (Sf3b6)
 Complex B
    66055 (Sf3b6)
 Complex C
   U2 SnRNP specific factors
    66055 (Sf3b6)
SSDB
Motif
Pfam: RRM_1 RRM_5
Other DBs
NCBI-GeneID: 66055
NCBI-ProteinID: NP_079599
MGI: 1913305
Ensembl: ENSMUSG00000037361
UniProt: P59708
Position
12; 12 A1.1
AA seq 125 aa
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTA
YVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGIN
TDPPK
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcgatgcaagcggctaagagggcgaatattcgcctcccacctgaagtaaatcggatt
ttgtatataaggaatttgccatacaaaatcacagcagaagaaatgtatgatatatttggg
aaatatggacctattcgtcaaatcagagtagggaatacacctgaaaccagaggaacagcc
tatgtggtctatgaggacatctttgatgctaagaatgcctgcgaccacctatcaggattc
aacgtttgtaacagataccttgtggttttgtattacaatgctaaccgggcatttcagaag
atggacaccaagaagaaggaggagcagctgaaacttctcaaggaaaagtatggcatcaac
acagatcctcccaagtga

DBGET integrated database retrieval system