KEGG   Mus musculus (mouse): 66058
Entry
66058             CDS       T01002                                 

Symbol
Tmem176a, 0610011I04Rik, AU040201, AU041743, Keg2
Name
(RefSeq) transmembrane protein 176A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 66058
NCBI-ProteinID: NP_001091741
MGI: 1913308
Ensembl: ENSMUSG00000023367
Vega: OTTMUSG00000057391
UniProt: Q9DCS1
Position
6:48818417..48822298
AA seq 244 aa
MSTDMETAVVGKVDPEAPQPTHIDVHIHQESALAKLLLAGCSLLRIPASASTQSQGSSRV
LVASWVVQTVLGALSVVLGGTLYIGHYLAMYSEGAPFWTGIVAMLAGAVAFLHKKRGGTC
WALMRTLLVLASFCTAVAAIVIGSRELNFYWYFLGDDVCQRDSSYGWSTMPRTTPVPEEA
DRIALCIYYTSMLKTLLMSLQAMLLGIWVLLLLASLTPVCVYIWKRFFTKAETEEKKLLG
AAVI
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtccacagacatggagactgcagtcgtcggcaaggtggaccctgaggctccacaaccc
acccacattgatgtgcacatccaccaggagtctgctctggccaaacttctgctggccgga
tgctcattgctaaggattccagcatccgcttccacccagagccagggcagcagcagagtg
ctggtggcctcctgggtggtgcagactgtgctgggggctctgagtgtggttctgggtgga
accctctacataggccattatttagccatgtattccgaaggcgcccccttctggactggg
atcgtggctatgctggctggagctgttgccttccttcacaagaaacggggtggtacctgc
tgggccctgatgaggacccttcttgtgctggcaagtttctgcaccgctgtggctgccatc
gttattgggtctcgtgagttgaatttttactggtattttctcggagatgatgtctgtcaa
agagactcttcatatggatggtccaccatgcctagaaccactccagttcccgaagaagct
gataggattgccttgtgcatatactacacaagcatgctaaagaccctgctcatgagcctc
caagctatgctcttgggtatctgggtgctgctgctcctggcttctctcacccctgtatgt
gtctacatctggaaaagatttttcacaaaggcggaaacagaggagaagaaactgctgggt
gcagctgtgatctag

DBGET integrated database retrieval system