KEGG   Mus musculus (mouse): 66059
Entry
66059             CDS       T01002                                 

Symbol
Krtcap2, 0610010I12Rik, Kcp2
Name
(RefSeq) keratinocyte associated protein 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Keratin_assoc
Other DBs
NCBI-GeneID: 66059
NCBI-ProteinID: NP_079603
MGI: 1913309
Ensembl: ENSMUSG00000042747
Vega: OTTMUSG00000022000
UniProt: Q5RL79
Position
3; 3 F1
AA seq 136 aa
MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN
LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA
PVLTPAKITGKGKKRN
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtagtcggtaccgggacctccttggcgctgtcctccctcctgtccctgctgctcttc
gctggcatgcagatctacagccgccagctggcctccaccgagtggctcaccattcagggg
ggcctgctgggctccggccttttcgtcttctccctgactgccttcaataatctggagaat
ctggtctttggtaaaggcttccaagcaaaaatcttccctgagattctcctctgcttgctg
ttggcgctctttgcctccggcctcatccaccgagtttgtgtcaccacttgcttcatcttc
tccatggttggtctgtactacatcaacaagatatcgtccactctgtaccaggcaacagct
ccagttctcacaccggccaaaatcactggcaagggcaagaagagaaactaa

DBGET integrated database retrieval system