KEGG   Mus musculus (mouse): 66061
Entry
66061             CDS       T01002                                 

Symbol
Dynlt2b, 0610012D17Rik, 2410011K15Rik, Tctex1d2
Name
(RefSeq) dynein light chain Tctex-type 2B
  KO
K22866  tctex1 domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66061 (Dynlt2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    66061 (Dynlt2b)
SSDB
Motif
Pfam: Tctex-1
Other DBs
NCBI-GeneID: 66061
NCBI-ProteinID: NP_079605
MGI: 1913311
Ensembl: ENSMUSG00000014075
Vega: OTTMUSG00000025781
UniProt: Q9CQ66
Position
16; 16 B3
AA seq 144 aa
MAVSFRGLSLSAHSEGLSEVDKNSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEELAS
AEYSPDEMPQLTKRLSEMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTD
NYTHDVFMNDSLFCVVAAFGCFYY
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctgtgtccttccgcggcctgtccttatcggctcactccgagggcttgagtgaggtc
gacaagaactcaggggagcctgagaacacctacattctgaggcccattttccagcaaagg
tttagaccctctgtggttaaagactgcatccatactgtgctcaaggaagaattggcaagt
gctgaatattctccagatgaaatgcctcaactcacaaaacgtctatcagaaatgattaaa
gataagctaaaagaattgggatatgaccggtataaaatggtggtgcaagtggtgattgga
gagcagaggggtgaaggagtattcatggctgctcgctgtttctgggatgcagacacggac
aactacactcacgatgttttcatgaacgacagcttattctgtgtggtggcagcatttggg
tgtttctactattga

DBGET integrated database retrieval system