KEGG   Mus musculus (mouse): 66071
Entry
66071             CDS       T01002                                 

Gene name
Ethe1, 0610025L15Rik, Hsco
Definition
(RefSeq) ethylmalonic encephalopathy 1
  KO
K17725  sulfur dioxygenase [EC:1.13.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00920  Sulfur metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    66071 (Ethe1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66071 (Ethe1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.18  persulfide dioxygenase
     66071 (Ethe1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    66071 (Ethe1)
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-GeneID: 66071
NCBI-ProteinID: NP_075643
MGI: 1913321
Ensembl: ENSMUSG00000064254
Vega: OTTMUSG00000031266
UniProt: Q9DCM0
Position
7; 7 A3
AA seq 254 aa
MASAVVRVAGRRLSQQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHR
DAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSI
RFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHE
KIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPQQIDIA
VPANMRCGVQTPPS
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcgagcgcggtcgtcagggtcgccgggcggcggctgagccagcaaagcgcatccgga
gccccggtcctcctgcggcagatgtttgaacccaagagctgcacctatacctaccttctg
ggtgaccgggagtcaagagaggcagttctgatcgaccccgttctggagacagcgcatcgg
gatgctcagttgattaaggagctggggctcaagctgttgtacgctgtgaacactcactgc
catgctgaccacatcaccggcacgggggttctccggtccctgctcccgggctgccagtct
gtcatctcccgcctcagcggagcccaggctgatttgcatatcggggaaggtgattccatc
cgctttggacgctttgctttggagactcgagccagccctggccacactccaggctgtgtc
acctttgtcctgaacgaccagagcatggccttcactggagatgccctgctgatccgaggg
tgtggacggacagacttccaacaaggctgtgctaagactttgtaccactctgtgcacgag
aagatcttcacacttccaggcaactgtctaatctacccggctcacgattaccacgggctc
acagtttctactgtggaggaggaacggactctgaacccacggcttaccctcagctgtgag
gaatttatcaaggtcatggacaacctgaacttgcccaagccacagcagatagacattgct
gttcctgcaaatatgcgctgtggggtccagactccaccctcctga

DBGET integrated database retrieval system