KEGG   Mus musculus (house mouse): 66072
Entry
66072             CDS       T01002                                 
Symbol
Sdhaf2, 0610038F07Rik, AA407634, AW049997
Name
(RefSeq) succinate dehydrogenase complex assembly factor 2
  KO
K18168  succinate dehydrogenase assembly factor 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66072 (Sdhaf2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-II assembly factors
    66072 (Sdhaf2)
SSDB
Motif
Pfam: Sdh5 TFIIE_alpha
Other DBs
NCBI-GeneID: 66072
NCBI-ProteinID: NP_079609
MGI: 1913322
Ensembl: ENSMUSG00000024668
UniProt: Q8C6I2
Position
19:complement(10477876..10502573)
AA seq 164 aa
MAVVTLIPTLARALSKHSLLSPLPSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDES
IETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWA
TEAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDLEYLFEKPH
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcggtggtcaccttgatcccgacgctggcgcgggcactgtcaaagcacagtctgctg
tctcccttgcctagtgtgacatcattcagacgcttctacagaggtgacagcccaacagac
tctcaaaaagacatgattgaaatccctttgcctccgtggcaggagagaactgatgaatcc
atagaaaccaaaagagcccgcttactctatgagagcagaaagagggggatgctggagaac
tgcattctccttagcctgtttgctaaagagtatctgcacaacatgacagagaagcagctg
aacctctatgatcgcctgattaacgagcctagcaatgactgggatatttactactgggcc
acagaagcaaaaccagccccagaaatatttgaaaatgaagtcatggaattgctgagagaa
ttcgccaaaaacaaaaacaaggagcagagactgcgtgccccagatctggagtatctcttt
gaaaagcctcattaa

DBGET integrated database retrieval system