KEGG   Mus musculus (house mouse): 66075
Entry
66075             CDS       T01002                                 
Symbol
Chchd3, 0610041L09Rik, 1700039J09Rik, Micos19
Name
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 3
  KO
K17563  MICOS complex subunit MIC19
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    66075 (Chchd3)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66075 (Chchd3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     66075 (Chchd3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MICOS complex
    66075 (Chchd3)
SSDB
Motif
Pfam: MIC19_MIC25 CHCH DUF885 NDUF_B7 DUF1690 ECH_2
Other DBs
NCBI-GeneID: 66075
NCBI-ProteinID: NP_079612
MGI: 1913325
Ensembl: ENSMUSG00000053768
UniProt: Q9CRB9
Position
6:complement(32769142..33037206)
AA seq 227 aa
MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDE
DLKRRVAEELALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKA
KHLARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYH
PVCADLQTKILQCYRQNTQQTLSCSALASQYMHCVNHAKQSMLEKGG
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggcgggaccgctagcacccgccgggtcaccttcgaggcggacgagaacgagaacatc
accgtggtgaagggcatccggctttcagaaaatgtgatcgaccggatgaaggagtcctct
ccatctggctctaagtctcagcgatattccagcgtttatggtgcttcagtttctgatgaa
gatttgaaaagaagagtagctgaggagctggcattggagcaagccaaaaaggagtcagaa
caccagagacgccttaagcaagcaagggacctagaaagagaaagggctgcagccaatgag
cagctgaccagagctgtccttcgggaaagaatatccagtgaagaggagcgcatgaaggcg
aagcatctggctcggcagctggaagagaaagaccgagtgatgcggaagcaggatgcattc
tacaaagagcagctggccagactggaggagaggagctcagagttctacaaagtcaccacc
gaggagtatcagaaagctgctgaagaggtggaagccaagttcaagcggtatgaatatcat
ccagtctgtgcagatctgcagaccaaaatcctccagtgttaccgtcagaacacccagcag
actctcagctgctctgctctggctagccaatacatgcactgtgtcaaccatgccaaacag
agcatgctggagaagggaggctaa

DBGET integrated database retrieval system