KEGG   Mus musculus (mouse): 66082Help
Entry
66082             CDS       T01002                                 

Gene name
Abhd6, 0610041D24Rik, AA673485, AV065425
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66082 (Abhd6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    66082 (Abhd6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     66082 (Abhd6)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S33
   66082 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr FSH1 Lipase DUF1057 DLH Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 66082
NCBI-ProteinID: NP_001317993
MGI: 1913332
Ensembl: ENSMUSG00000025277
UniProt: Q8R2Y0
Position
14; 14 A1
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgatgtggttaacatgtttgtgattgcgggtgggaccctggccattccaatc
ctggcatttgttgcgtctttcctcctgtggccttcagcactgataagaatctattattgg
tactggcggaggacactgggcatgcaagttcgctacgcacaccatgaggactatcagttc
tgttactccttccggggcaggccaggacacaagccatccatccttatgctccatggattc
tccgcacacaaggacatgtggctcagcgtggtcaagttccttccgaagaacctgcacttg
gtctgtgtggacatgcctgggcatgaaggcaccacccgctcctccctggatgacctgtcc
atagtggggcaagttaaaaggatacatcagtttgtagaatgccttaagctgaacaaaaag
ccctttcaccttataggcacctccatgggtggccacgtggctggagtatatgccgcttac
tacccatctgatgtctgcagcctgtctctcgtgtgtcctgctggcctgcagtactcaact
gacaatccttttgtacaacggctcaaagagctggaggagtcagctgccattcagaagatt
cccttgatcccatccaccccggaagagatgagtgagatgctgcagctctgctcctatgtc
cgcttcaaggtgccccagcagatccttcaaggtcttgtcgatgttcgcattcctcataac
agcttctaccggaaattgtttttggaaatcgtcaatgagaaatccagatactctctgcat
gagaatatggacaagatcaaggtcccgacacagatcatttgggggaaacaagaccaggtg
cttgatgtgtccggggcagacatattagccaagtcaatctctaactcccaggtagaggtt
ctggaaaactgtggccattcggtagtgatggagagaccgaggaagacagccaagctcatt
gtcgactttttagcttctgtgcataacacagacaacaagaagctgaactga

DBGET integrated database retrieval system