KEGG   Mus musculus (mouse): 66084
Entry
66084             CDS       T01002                                 

Gene name
Rmnd1, 0610042C05Rik, AA408137, AI462664, AW536662
Definition
(RefSeq) required for meiotic nuclear division 1 homolog
  KO
K23499  required for meiotic nuclear division protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66084 (Rmnd1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    66084 (Rmnd1)
SSDB
Motif
Pfam: DUF155
Other DBs
NCBI-GeneID: 66084
NCBI-ProteinID: NP_079619
MGI: 1913334
Ensembl: ENSMUSG00000019763
Vega: OTTMUSG00000030953
UniProt: Q8CI78
Position
10; 10 A1
AA seq 450 aa
MPSRLLHTLASLHSISAKAHQCQRLTWLTLRPLRKSESTTCHNGLTIQQHLHSFFPSITA
DSLNKPEILEMSRITSDTSRLFPLNAVHWLDGKEHWPSMHPFGTHRSMTHKPNLLCSKWF
IKAVKRHHSSVSNEALVPKQDLPQIKRPLKASRTRQPSRTNLPDLSVNEDLMQCTAFATA
DEYHLGSLSQELVSCGYVEVTSLPRDAANILVMGVESSAKEGDPGTIFLFREGAAVFWNV
KEKTMKHVMQVLERHETQPYEVALVHWENEELNYIKTEGQSKLHRGEIKLNSELDLDDAI
LEKFAFSNALCLSVKLAIWEATLDKFIESIQSIPEALKAGKKVKLSHKEVMQKMGELFAL
RHRINLSSDFLITPDFYWDRANLEELYDKTCQFLSITRRVKVMNEKLQHCMELTDLMRNH
LNEKRALRLEWMIVILITIEVMFELGRVFF
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgccatccaggcttctccacaccctggcaagtttacacagcatatcagcaaaggctcat
cagtgccagagacttacttggcttacattaagaccacttaggaaatctgaaagtacaaca
tgccacaatggcctgacaatacagcaacatttacactcattctttccaagtataacagct
gacagtttgaataagccagagatcctggaaatgagccggataacatcagacacaagcaga
ctctttccgttaaatgctgtccattggttggacggcaaagaacactggccaagcatgcac
ccctttgggactcacaggagcatgacccacaaaccaaatctcttgtgttctaagtggttt
ataaaagcagtaaagaggcatcactcatctgtatcaaatgaagcacttgttcccaaacaa
gaccttccgcagatcaagaggccgctgaaagcatcccggacccggcagccatccaggacc
aaccttccagatctgtctgtgaatgaggacctgatgcagtgcacagcatttgcaaccgca
gatgagtatcacctgggaagtctgtctcaagagctggtctcctgtggctatgtggaagtg
acaagcctgcctagagatgcagcaaatattttggtgatgggtgtggaaagttctgcaaaa
gaaggtgatcccggaacaatattcttgttcagggaaggagctgctgtgttctggaatgta
aaagaaaaaactatgaagcacgtgatgcaagttctagagagacacgaaacccagccctat
gaagtggctctcgttcactgggagaacgaagaactcaactacataaagacagagggacaa
tcaaaactgcacagaggggaaatcaagctaaactctgagctggacttggatgacgccatt
ctagagaaatttgcgttctccaacgctctctgcctgtcagtgaagctggctatttgggaa
gcaaccctggacaaatttattgagtctattcagtccattccagaggcattaaaagctggg
aagaaagtcaaactgtctcataaagaagttatgcagaaaatgggtgagctctttgccctc
aggcaccgaataaacctgagctcagatttcttgatcacccctgacttctactgggacaga
gcaaacctggaagagctttatgacaagacctgccagttccttagcatcacgcgaagagtt
aaggtcatgaatgaaaaactgcagcactgcatggaactaacagacctaatgcggaatcac
ctcaatgagaagcgagcactccgcttggagtggatgatcgtcatcctcatcaccattgag
gtaatgtttgagctggggagagtcttcttctga

DBGET integrated database retrieval system