KEGG   Mus musculus (mouse): 66092Help
Entry
66092             CDS       T01002                                 

Gene name
Ghitm, 1010001P14Rik, C77840, MICS1, PTD010, Tmbim5
Definition
(RefSeq) growth hormone inducible transmembrane protein
  KO
K21890  growth hormone-inducible transmembrane protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    66092 (Ghitm)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   66092 (Ghitm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bax1-I
Motif
Other DBs
NCBI-GeneID: 66092
NCBI-ProteinID: NP_001186051
MGI: 1913342
Ensembl: ENSMUSG00000041028
UniProt: Q91VC9
Position
14 B; 14 21.29 cM
AA seq 346 aa AA seqDB search
MLAARLVCLRTLPSRVFQPTFITKASPLVKNSITKNQWLVTPSREYATKTRIRTHRGKTG
QELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNEIGAIEKAVIWPQY
VKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHS
ISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSE
KFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVI
KRAEITPMYGAQKYDPINSMLTIYMDTLNIFMRVATMLATGSNRKK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgcaaggcttgtgtgtctccggacactaccttccagggttttccagcccact
ttcatcaccaaggcctctccacttgtgaagaattccatcacaaagaaccaatggctcgta
acacccagcagggaatatgctaccaagacaagaattaggactcaccgtgggaaaactgga
caagaactgaaagaggcagccttggaaccatcaatggaaaaaatctttaaaatcgatcaa
atgggaaggtggtttgttgctggaggagcagctgttggtcttggagcgctctgctactat
ggcttgggaatgtctaatgagattggagctatcgaaaaggctgtaatttggcctcagtat
gtaaaggatagaattcattctacttacatgtacttagcaggaagtattggtttaacagct
ttgtctgccttggcagtagccagaacacctgctctcatgaacttcatgatgacaggctct
tgggtgacaattggtgcgacctttgcagccatgattggagctggaatgcttgtacactca
atatcatatgagcagagcccaggcccaaagcatctggcttggatgctgcattctggtgtg
atgggtgcagttgtggctcctctgacgatcttaggggggcctcttctcctgagagccgca
tggtacaccgctggtattgtgggaggcctctctactgtggccatgtgtgcgcctagtgag
aagtttctgaacatgggagcacccctgggagtgggcctgggtcttgtctttgcgtcttct
ctggggtctatgtttcttccccctacctctgtggctggtgccactctgtactcagtggca
atgtatggtggattagttcttttcagcatgttccttctgtatgatactcagaaagtaatc
aaacgtgcagaaataacacccatgtatggagctcaaaagtatgatcccatcaattcgatg
ttgacaatctacatggatacattaaatatatttatgcgagttgcaactatgctagcaact
ggaagcaacagaaagaaatga

DBGET integrated database retrieval system