KEGG   Mus musculus (mouse): 66096
Entry
66096             CDS       T01002                                 

Gene name
Lamtor4, 0910001L09Rik, AV006840
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
  KO
K20399  ragulator complex protein LAMTOR4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66096 (Lamtor4)
SSDB
Other DBs
NCBI-GeneID: 66096
NCBI-ProteinID: NP_001074577
MGI: 1913346
Ensembl: ENSMUSG00000050552
Vega: OTTMUSG00000022731
UniProt: Q8CF66
Position
5; 5 G2
AA seq 99 aa
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFQLHHGTN
IPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttccgcactgacccaagggctggagcgaatcccagaccagcttggctacctggtg
ctgagcgaaggtgcagtgctggcgtcatctggggaccttgagaacgatgagcaagcagcc
agtgccatctcggagttggtcagcacagcctgtggcttccagttgcaccatggcacgaac
atccctttcaaacgcctgtctgtggtctttggtgaacacacgctgctggtgactgtgtca
ggacagagggtgtttgtagtgaagaggcagaaccgaggtcgtgaacctattgatgtctga

DBGET integrated database retrieval system