KEGG   Mus musculus (mouse): 66098
Entry
66098             CDS       T01002                                 

Gene name
Chchd6, 0710001P09Rik, 1700021B03Rik, Mico, Micos25
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 6
  KO
K17564  MICOS complex subunit MIC25
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    66098 (Chchd6)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66098 (Chchd6)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     66098 (Chchd6)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MICOS complex
    66098 (Chchd6)
SSDB
Motif
Pfam: DUF737 CHCH NDUF_B7 hDGE_amylase Exonuc_VII_L
Other DBs
NCBI-GeneID: 66098
NCBI-ProteinID: NP_079627
MGI: 1913348
Ensembl: ENSMUSG00000030086
Vega: OTTMUSG00000057681
UniProt: Q91VN4
Position
6; 6 D1
AA seq 273 aa
MGSAESAEARRVSFEMDEEERVRVLQGIRLSESVVNRMKDCSQPSAGEQLVPGFGPSSSA
PVPTVPLPAISVPTVPAPTTPVPTAPSSSVRGLPGGTCKGPLTDVKVPSAESGGGLQSSA
VKEDLKKFQQEQLAVQDEMVRVAKKEKEAAEKHLKASLPKKKASLTHEQQQSARLARELE
DREAELSRRDTFYKEQQGRIQEKNAELYKLSSQQFHEAASKAESTIKPRRVEPVCSGLQA
QILRCYRDHLHEVLLCSDLVKAYQHCVSTARKG
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggcagcgccgagagcgccgaggcccgaagggtgtccttcgagatggatgaggaggag
cgggtccgggtgctgcagggcatccggctgtctgaaagtgttgtgaaccgcatgaaggat
tgcagccagccttcagcaggggaacagctggttcctggttttggtccttcgtcttctgct
cctgtgcccactgtccctctaccagccatctctgtgcccactgtccctgcacctaccact
cctgtgcctactgctccttcatcctctgtacgtggcctgccaggaggcacctgtaaaggc
cctctgacagacgttaaagtgcccagtgcagagagtggtggtggtctgcagtcctcagca
gtgaaggaggatcttaagaagttccaacaggagcagttggcagtccaggatgagatggtc
agggtggcaaaaaaggaaaaagaggcagctgagaagcacttgaaggcatccctgcccaag
aagaaggccagcctcacccatgagcaacagcagtcagctcgactagccagggaactggag
gacagagaggccgagctcagccgccgtgacaccttctacaaggagcagcaggggcgcatc
caggaaaagaatgctgagctgtataaactgtcttcccaacaattccatgaggcggcttca
aaagcagagagcacaataaagccccgcagagtggagcctgtgtgctctggcctacaagcc
cagatcctccgctgttaccgggaccatctgcatgaagtgcttctgtgctcggacctggtc
aaggcataccagcactgtgtgagcactgcccgcaagggctga

DBGET integrated database retrieval system