KEGG   Mus musculus (house mouse): 66104
Entry
66104             CDS       T01002                                 
Symbol
Tceal6, 1500026B10Rik
Name
(RefSeq) transcription elongation factor A (SII)-like 6
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: BEX
Other DBs
NCBI-GeneID: 66104
NCBI-ProteinID: NP_079631
MGI: 1923939
Ensembl: ENSMUSG00000031409
Position
X:complement(134109435..134111436)
AA seq 200 aa
MEEVRGENEGKLEKEGKPEDEVEPEDEEKSDEEEKPDKKAKPAPRQGKPEEEAKPDEQGQ
DEGKPEKQGKSDGEGKRQGESKPDSQAKSASEARAAEKRPAEDYVPRKAKRKTDRGTDDS
PKNSQEDLQDRHVSSEEMMRECTDMTRAREELRKRQKMGGFHWVPRDAQDALVPRGQRGV
RGVRGGGGRSQRGLHDIPYL
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaagaagtccgcggtgaaaacgaaggcaagctggaaaaggagggaaagccagaagat
gaagtagagcctgaagatgaagaaaagtcagatgaggaagagaagccagacaagaaagca
aagccagcaccacgccagggcaagccagaggaggaggcaaagccagatgagcaggggcaa
gatgaggggaagcccgagaagcagggaaagtctgacggggagggcaagcgccaaggggag
agcaagcccgattcccaggcaaagtcagccagcgaggcgcgggctgcagaaaagcgccct
gctgaagattatgtgccccggaaagcaaaacgaaaaacagatagggggacagatgattct
cccaagaactcccaggaggacttacaggacaggcatgtaagcagcgaggagatgatgaga
gagtgcacagatatgactagggctcgggaagagttaaggaagaggcagaaaatgggtggt
tttcactgggtgccaagagatgcacaggatgctttagtccccaggggccagcggggagtc
aggggggtgaggggcggcggaggcaggagccagaggggcctacatgacatcccatacctt
taa

DBGET integrated database retrieval system