KEGG   Mus musculus (mouse): 66111
Entry
66111             CDS       T01002                                 

Gene name
Tmed3, 1200002G13Rik, AW546672, P24b
Definition
(RefSeq) transmembrane p24 trafficking protein 3
  KO
K20350  p24 family protein gamma-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66111 (Tmed3)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    66111 (Tmed3)
SSDB
Motif
Pfam: EMP24_GP25L
Other DBs
NCBI-GeneID: 66111
NCBI-ProteinID: NP_079636
MGI: 1913361
Ensembl: ENSMUSG00000032353
Vega: OTTMUSG00000046286
UniProt: Q78IS1
Position
9; 9 E3.1
AA seq 221 aa
MVHEAPHASSFQMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQ
VITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYF
DFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLN
SRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPVNRAVHS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggtccacgaggctccgcacgcttcatccttccagatgctgctacagctgctgcttctg
ctcctgctccgggccgagccactgcggagcgctgagctcaccttcgagctgccggacaac
gccaagcagtgcttccacgaagaggtggagcagggcgtgaagttctctctggattaccag
gttatcactggaggccactacgatgtggactgctatgtggaagaccccaggggcaacgtc
atctacagggagaccaagaagcagtatgacagcttcacgtacaagacagaggccaagggc
gtctaccggttttgcttcagtaatgagttctccaccttctctcataagaccgtctacttt
gacttccaagtgggtgacgagccccccattctcccagacatggggaacagggtcacggct
ctcactcagatggaatctgcctgtgtaactattcacgaggctctgaagactgtgatcgac
tcccagacacactatcgactgcgggaggctcaggaccgagcccgagctgaagaccttaat
agtcgagtgtcctactggtctgtaggcgagactattgccctgtttgtggtcagcttcagc
caggtgctactgctgaaaagcttctttacagaaaagcgacctgttaacagagcggtccac
tcctag

DBGET integrated database retrieval system