KEGG   Mus musculus (house mouse): 66112
Entry
66112             CDS       T01002                                 
Symbol
Mtarc1, 1300013F15Rik, Marc1, Mosc1
Name
(RefSeq) mitochondrial amidoxime reducing component 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: MOSC_N MOSC DUF202
Other DBs
NCBI-GeneID: 66112
NCBI-ProteinID: NP_001277202
MGI: 1913362
Ensembl: ENSMUSG00000026621
UniProt: Q9CW42
Position
1:complement(184518964..184543622)
AA seq 340 aa
MGAGSWALTLFGFSAFRVPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRRLQQVGT
VAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISL
TCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQS
CRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNF
RPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSY
RLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggtgcggggtcctgggcgctgaccctcttcggcttctccgcgtttcgggtcccgggc
cagccgcggtccacctggctcggcgtcgccgcgctgggactggccgcggtggccctgggg
acagtggcctggcgtcgtgcgcgtccccggcgacgccggcggctacagcaagtgggaacg
gtggcacagctctggatctacccaatcaagtcctgcaaggggttgtcggtgagcgaggca
gagtgcactgccatggggctgcgctatggccacctgcgcgacaggttttggctcgtgatc
aatgaagaggggaacatggtcactgcccggcaggagcctcgattggtcctgatttctctg
acctgtgaggacgacaccttgactctcagtgcagcttacacaaaggacctgctgctgcct
atcaccccgcctgccacaaacccactcctccagtgcagagtgcatggcctggagatacag
ggcagggattgtggagaggatgcagctcagtgggtcagcagcttcttgaagatgcagtcc
tgtcgcctggtgcacttcgagccgcacatgcgccccagaagttctcggcaaatgaaggct
gtgttccggaccaaggaccaggtggcctactcagatgcaagtccattcttggtcctttct
gaggcatccttggaagatctcaactccaggctggagcgcagagtgaaagcgacaaacttc
aggcctaacattgtcatctcgggatgtggcgtttatgctgaggattcttggaacgaggtt
ctcattggagatgtggaactgaaacgggtgatggcttgtacccggtgccttttaacaaca
gtggatccagacactggcatctcggacaggaaggagcctctggaaacactgaagagctac
cgcctgtgtgacccttccgagcaagcactatatggaaagttacccatctttggacaatac
ttcgctctggaaaatccagggacaatcagagtgggagaccctgtgtacctcctgggccag
tga

DBGET integrated database retrieval system