KEGG   Mus musculus (house mouse): 66117
Entry
66117             CDS       T01002                                 
Symbol
Fmc1, 1110001J03Rik
Name
(RefSeq) formation of mitochondrial complex V assembly factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Complex1_LYR_2 Phg_2220_C
Other DBs
NCBI-GeneID: 66117
NCBI-ProteinID: NP_079639
MGI: 1913367
Ensembl: ENSMUSG00000019689
Vega: OTTMUSG00000024224
UniProt: Q9CR13
Position
6:38511796..38516384
AA seq 113 aa
MAALGSPARTLRGLLRELRYLNAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELH
FQAATYLCLLSSIRQHVALHQEFHGKGERSVEESAGLVGLQLPRQPGGKGWEP
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcggccctggggtccccggcgcgcactctgcggggccttctgagggagctgcgctac
ctgaacgcggccaccgggcggccatatcgcgacacagcggcctaccggtacctcgttaag
gctttccgagcacatcgggttaccagtgagaagttgtgtagagcccaacacgaacttcac
ttccaagctgccacctatctctgccttttgagtagcatccggcaacatgtagcccttcat
caggaatttcatggcaagggtgagcgttcagtggaggagtctgctggtttagtgggcctc
cagttgccccgtcagcctggagggaagggctgggagccgtga

DBGET integrated database retrieval system