KEGG   Mus musculus (house mouse): 66118
Entry
66118             CDS       T01002                                 
Symbol
Sarnp, 1110005A23Rik, Cip29
Name
(RefSeq) SAP domain containing ribonucleoprotein
  KO
K18732  SAP domain-containing ribonucleoprotein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    66118 (Sarnp)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     66118 (Sarnp)
SSDB
Motif
Pfam: Tho1_MOS11_C SAP SAP_new25 LETM1_RBD
Other DBs
NCBI-GeneID: 66118
NCBI-ProteinID: NP_079640
MGI: 1913368
Ensembl: ENSMUSG00000078427
UniProt: Q9D1J3 B2RXM7
Position
10:128657633..128713507
AA seq 210 aa
MAAETVELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEDHAEEEANEEDVLGDET
EEEEPKPIELPVKEEEPPEKAVDMASEKKVVKITSGIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcggccgagacggtggagctccacaagctgaagcttgctgaactaaagcaagaatgt
cttgctcgtggtttagagaccaagggaataaaacaagatcttataaataggctgcaggcc
tatcttgaagaccatgcagaagaagaagcaaatgaagaagatgtactgggagatgaaact
gaggaagaagaaccaaagcccatagaactgcctgttaaagaggaagaacctcctgaaaag
gctgttgatatggcatcggaaaagaaggtggtaaagattacatctgggatacctcagact
gaaagaatgcagaagagggctgaacgattcaatgtacctgtaagcctggagagtaagaag
gctgcccgggcggctaggtttggaatttcttcagttccaacaaaaggtttatcatctgac
accaagcctatggttaacctggataaactaaaggaaagagcacagagatttggtttgaat
gtctcttccatctctagaaagtctgaggatgatgagaagctgaagaaacggaaggagaga
tttgggattgtgacaagttcagctggaactggaaccacagaggatacagaggcaaagaaa
agaaaaagagcagagcgttttggaattgcataa

DBGET integrated database retrieval system