KEGG   Mus musculus (house mouse): 66121
Entry
66121             CDS       T01002                                 
Symbol
Chchd1, 1110001O19Rik, 2400010G13Rik, MRP-S37
Name
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CHCH PGP_phosphatase MTCP1
Other DBs
NCBI-GeneID: 66121
NCBI-ProteinID: NP_079642
MGI: 1913371
Ensembl: ENSMUSG00000063787
UniProt: Q9CQA6
Position
14:20753095..20754493
AA seq 118 aa
MATPSLRGRLARFANPGKPILKPNKPLILANRVGNRRREKGEATCITEMSMMMACWKQNE
FRDEACRKEIQDFFDCSSRAQEARKMRSIQESLGQSESLSPHKMTKLLQRFPNKSHLI
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgacgcccagtctacgcggccgcctggcgcggtttgcgaacccgggaaaacctata
ctgaaacccaacaagcctcttatcttagctaaccgcgtcgggaaccgacgtagagaaaag
ggagaggcaacctgtatcacggagatgtcgatgatgatggcttgctggaagcagaatgaa
ttccgcgacgaggcgtgcaggaaagagatccaggacttcttcgattgttcttccagggct
caggaagccaggaagatgagatcaatccaggagtctctgggacagtccgagagtttatct
ccccacaagatgaccaagttgttacagagatttcccaacaaatctcatctcatctga

DBGET integrated database retrieval system