KEGG   Mus musculus (house mouse): 66126
Entry
66126             CDS       T01002                                 
Symbol
Elof1, 1110011K10Rik
Name
(RefSeq) ELF1 homolog, elongation factor 1
  KO
K25829  transcription elongation factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66126 (Elof1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      66126 (Elof1)
SSDB
Motif
Pfam: Elf1 zf-RING_UBOX SIR2 zf-Sec23_Sec24
Other DBs
NCBI-GeneID: 66126
NCBI-ProteinID: NP_740747
MGI: 1913376
Ensembl: ENSMUSG00000013822
UniProt: P60003 Q545S6
Structure
Position
9:complement(22024282..22028491)
AA seq 83 aa
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTP
ITYLSEPVDVYSDWIDACEAANQ
NT seq 252 nt   +upstreamnt  +downstreamnt
atgggacgaagaaagtccaaacggaagccgcccccaaaaaagaagatgacaggcaccctg
gagacccagttcacctgccctttctgcaaccacgagaagtcttgtgatgtgaaaatggac
cgtgctcgaaacactggagtcatctcctgtactgtgtgcctagaggaattccagacaccc
atcacatacctgtcagaaccagtggatgtgtacagcgactggatagatgcctgcgaggca
gccaatcagtag

DBGET integrated database retrieval system