KEGG   Mus musculus (mouse): 66136
Entry
66136             CDS       T01002                                 

Gene name
Polr1h, 1110014N07Rik, Rpa12, Znrd1
Definition
(RefSeq) RNA polymerase I subunit H
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    66136 (Polr1h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66136 (Polr1h)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     66136 (Polr1h)
SSDB
Motif
Pfam: TFIIS_C DZR zf-ribbon_3 OrfB_Zn_ribbon RNA_POL_M_15KD DUF3716 zf-NADH-PPase Zn_Tnp_IS1595 Ogr_Delta
Other DBs
NCBI-GeneID: 66136
NCBI-ProteinID: NP_075651
MGI: 1913386
Ensembl: ENSMUSG00000036315
Vega: OTTMUSG00000037385
UniProt: Q791N7
Position
17; 17 B1
AA seq 123 aa
MELARPRSNFQSDLDFCPDCGSVLPLPGIQDTVICSRCGFSIDVRDCEGKVVKTSVVFNK
LGATIPLSVDEGPELQGPVIDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCINCKFQEK
EDS
NT seq 372 nt   +upstreamnt  +downstreamnt
atggagctggcccgcccccgctccaactttcaatcagacttggatttctgcccagattgt
ggctcagtcctgccgctgcctggaattcaggacactgtcatatgttcgcgttgtggcttc
tccatcgatgtgcgagattgtgaagggaaggttgtgaagacctcagtagtgttcaacaag
ctgggggctaccatacctttgtctgtggatgagggacctgaattacagggaccagtgatt
gacaggcgctgccctcgatgtggtcacgagggaatggcatatcacaccagacagatgcgc
tcagctgatgaaggacagacggtcttctatacctgtatcaactgcaagtttcaggaaaag
gaagattcttga

DBGET integrated database retrieval system