KEGG   Mus musculus (house mouse): 66139
Entry
66139             CDS       T01002                                 
Symbol
Mymk, 1110002H13Rik, AI131587, Tmem8c, myomaker
Name
(RefSeq) myomaker, myoblast fusion factor
  KO
K24577  protein myomaker
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    66139 (Mymk)
SSDB
Motif
Pfam: DUF3522
Other DBs
NCBI-GeneID: 66139
NCBI-ProteinID: NP_079652
MGI: 1913389
Ensembl: ENSMUSG00000009214
UniProt: Q9D1N4
Position
2:complement(26951648..26962173)
AA seq 221 aa
MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPGLSVLCF
MRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRTFHDRWGYGVYSG
PIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGALALMLRFFFEEWDYTYVH
SFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTLCCTCV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggggacagttgtagccaaactgctcctgcctaccctcagcagcctggccttcctcccg
acagtgagcatcgctaccaagaggcgtttctacatggaggccatggtctacctcttcacc
atgttctttgtggcgttctcccatgcctgtgatgggcctggtttgtctgtgctgtgcttc
atgcgccgtgacattctggagtacttcagcatctatggaacagccctgagcatgtgggtc
tccctgatggcactggccgactttgatgaaccccagagatcgaccttcacaatgcttggc
gtccttaccatcgctgtgcggacttttcatgaccgctggggttacggggtatactccggt
cccataggcacggccaccctcatcattgctgtaaagtggctgaagaagatgaaagagaag
aagggcctgtaccccgacaagagcatctacacccagcagataggccccggcctgtgcttt
ggggccctggccctgatgcttcgattcttctttgaggaatgggattacacctacgtccac
agcttctaccactgtgccctggccatgtcctttgtcctgctgctgcccaaggtcaacaag
aaggctgggaacgcaggggcccccgccaagctgaccttctccaccctctgctgcacttgt
gtctga

DBGET integrated database retrieval system