KEGG   Mus musculus (mouse): 66143Help
Entry
66143             CDS       T01002                                 

Gene name
Eef1e1, 1110003A02Rik
Definition
(RefSeq) eukaryotic translation elongation factor 1 epsilon 1
  KO
K15439  eukaryotic translation elongation factor 1 epsilon-1
Organism
mmu  Mus musculus (mouse)
Brite
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    66143 (Eef1e1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 Tom37 GST_C_6
Motif
Other DBs
NCBI-GeneID: 66143
NCBI-ProteinID: NP_079656
MGI: 1913393
Ensembl: ENSMUSG00000001707
UniProt: Q9D1M4
Position
13; 13 A3.3
AA seq 174 aa AA seqDB search
MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHL
LGSTAEEKAMVQQWLEFRVTRVDGHSSKEDTQTLLKDLNSYLEDKVYLAGHNITLADILL
YYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPDIRQHLSSIVFIKNRLYANSH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcggagttgaggctgctggagaagagtctgggactgaagccggggaat
aagtacagtgctcagggcgagcggcagattccagttctacagacaaacaatggcccgagt
ctaatgggattgagtaccatcgccacccatctagtcaagcaggccagtaaggagcacttg
ctggggagcactgcagaagaaaaggcaatggttcagcagtggttagagttcagggtcact
cgagtagatggacactccagtaaagaagacacccagactctgctgaaggatcttaattcc
tatcttgaagataaagtctaccttgcaggacataacatcaccctggcggacatcctgctg
tactacggcctccaccgctttatagttgacctgacagttcaagaaaaggagaaatatctt
aatgtgtctcgctggttttgtcacattcaacattacccagacatcaggcaacatctgtcc
agtattgtcttcatcaagaacagactctatgctaactcccactag

DBGET integrated database retrieval system