KEGG   Mus musculus (mouse): 66152Help
Entry
66152             CDS       T01002                                 

Gene name
Uqcr10, 1110020P15Rik, AA960494, Ucrc
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66152 (Uqcr10)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66152 (Uqcr10)
  09159 Environmental adaptation
   04714 Thermogenesis
    66152 (Uqcr10)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    66152 (Uqcr10)
   05012 Parkinson disease
    66152 (Uqcr10)
   05016 Huntington disease
    66152 (Uqcr10)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    66152 (Uqcr10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-GeneID: 66152
NCBI-ProteinID: NP_932096
MGI: 1913402
Ensembl: ENSMUSG00000059534
Vega: OTTMUSG00000005067
UniProt: Q8R1I1 Q5NCJ9
Position
11; 11 A1
AA seq 64 aa AA seqDB search
MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
ENKE
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccgacgatcccttcgcgcctgtactccttgctgttccgcagaacttccacc
tttgccctcaccatcgcagtgggcgccctgttcttcgagcgagccttcgatcagggcgca
gacgcgatctacgagcacatcaacgaggggaaactgtggaaacatataaagcacaagtat
gagaacaaggagtaa

DBGET integrated database retrieval system