KEGG   Mus musculus (mouse): 66164Help
Entry
66164             CDS       T01002                                 

Gene name
Nip7, 1110017C15Rik, 6330509M23Rik, AA408773, AA410017, PEachy
Definition
(RefSeq) NIP7, nucleolar pre-rRNA processing protein
  KO
K07565  60S ribosome subunit biogenesis protein NIP7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    66164 (Nip7)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    66164 (Nip7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0113_N UPF0113 PUA PP1 PEPCK_GTP
Motif
Other DBs
NCBI-GeneID: 66164
NCBI-ProteinID: NP_079667
MGI: 1913414
Ensembl: ENSMUSG00000031917
Vega: OTTMUSG00000061931
UniProt: Q9CXK8
Position
8; 8 D3
AA seq 180 aa AA seqDB search
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccttgactgaagaagagacccgggtcatgtttgagaagatcgcgaagtacatc
ggagagaaccttcaactcctagtggacagacccgacggcacgtactgtttccggctgcac
aacgaccgagtgtactatgtgagtgagatgatgctgaagctggccgccaacatctccgga
gacaagctcgtgtcgctggggacgtgttttgggaagtttaccaagacccacaagttccgc
ttgcacgtgacagctctggattacctggccccctatgccaagtataaagtgtgggtaaag
ccgggagcagagcagtccttcttgtatggaaaccatgtgttgaaatccggtctgggtcga
attactgagaacacatctcagtaccagggagtggttgtctattccatggcggacattcct
ctgggttttggggtggcagcaaagtctacccaagactgccgaaaagtggaccccatggca
attgtggtgttccaccaagcagacattggggagtacgtacgccatgaagagacactgact
tag

DBGET integrated database retrieval system