KEGG   Mus musculus (mouse): 66175Help
Entry
66175             CDS       T01002                                 

Gene name
Mustn1, 1110028G01Rik, Mustang
Definition
(RefSeq) musculoskeletal, embryonic nuclear protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Mustang
Motif
Other DBs
NCBI-GeneID: 66175
NCBI-ProteinID: NP_852055
MGI: 1913425
Ensembl: ENSMUSG00000042485
UniProt: Q99JI1
Position
14; 14 B
AA seq 82 aa AA seqDB search
MSEAGTPEGPIKKKRPPVKEEDLKGARGTLAKNQDIKSKTYQVMRDYEQAGSAAPSVFSR
NRTGTETVFEKPKEGPAKSVFG
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcactcctgaaggccccatcaagaagaagcggccccctgtgaaggaa
gaagacctgaagggggcccgagggaccctggccaagaaccaggacatcaagtctaagaca
taccaggtcatgcgggactacgagcaagccggctcagctgccccatctgtattcagccgc
aaccgcacaggcaccgagacagtctttgagaagcccaaagagggaccagccaagagcgtg
tttggctga

DBGET integrated database retrieval system