KEGG   Mus musculus (mouse): 66192
Entry
66192             CDS       T01002                                 

Symbol
Lage3, 1110049G11Rik, Eso3, Itba2
Name
(RefSeq) L antigen family, member 3
  KO
K15902  EKC/KEOPS complex subunit PCC1/LAGE3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    66192 (Lage3)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    66192 (Lage3)
SSDB
Motif
Pfam: Pcc1
Other DBs
NCBI-GeneID: 66192
NCBI-ProteinID: NP_079686
MGI: 1913442
Ensembl: ENSMUSG00000015289
Vega: OTTMUSG00000017697
UniProt: Q9CR70 A0A158SIT5
Position
X:complement(73395768..73397224)
AA seq 148 aa
MQTAHTGLSHTADGADGQTSRCCPGNAGTKAVIPSGAHPVARALEASRNSSKSMVPLTQR
PGTRHHRFSLFVPFPTSLEAEIACGSLVPDVEPHRGLVGKELKVSGCMLEVRWIAEDSRL
LRLSIINFLDQLSLVVNTIQLFGPPVSC
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcagacagcacacacaggtttaagccacactgcagatggcgccgatggtcagactagc
cgctgttgtcctggtaatgcaggcacaaaggcagttattcccagtggagctcaccctgtt
gcaagagcactggaagcctcccgaaattccagcaaaagcatggtgcctttaacccaaagg
cctggaacccgacatcacagattctccctcttcgtgcctttcccgacctctttggaggca
gaaatcgcctgtgggtccctagttccagatgtcgaaccacatcgaggactggtagggaag
gagcttaaagtgagcggctgcatgctggaggtacgctggatcgcggaagattctcgcctc
ctccgactttccatcatcaactttcttgaccagctttccctagtggtgaacaccatacag
ctctttgggcccccagtttcctgttaa

DBGET integrated database retrieval system