KEGG   Mus musculus (mouse): 66194
Entry
66194             CDS       T01002                                 

Symbol
Pycrl, 1110058B13Rik, 2700073G24Rik, Pycr3
Name
(RefSeq) pyrroline-5-carboxylate reductase-like
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    66194 (Pycrl)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     66194 (Pycrl)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored DapB_N NAD_binding_2 NAD_Gly3P_dh_N PDH ApbA Shikimate_DH
Other DBs
NCBI-GeneID: 66194
NCBI-ProteinID: NP_079688
MGI: 1913444
Ensembl: ENSMUSG00000022571
UniProt: Q9DCC4
Position
15; 15 D3
AA seq 274 aa
MAATMSEPRRVGFVGAGRMAEAIARGLIQAGKVEAKQVLASAPTDNNLCHFRALGCQTTH
SNHEVLQNCPLVIFATKPQVLPTVLAEVAPIVTTEHIIVSVAAGISLSTMEGLLPPNTRV
LRVSPNLPCVVQEGAMVMARGHHAGNDDAELLQNLLEACGQCIEVPESYVDIHTGLSGSG
VAFVCTFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKMLQQEGKHPAQLRTDVLTPAGT
TIHGLHALERGGFRAATMSAVEAATCRAKELSKK
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcggcgacaatgtctgaacctcggcgtgtgggcttcgtgggtgcaggccgcatggcg
gaggccattgcccgaggcctcatccaagcaggcaaagtagaagctaaacaagtgctggcc
agtgcaccaacggacaacaacctctgccacttcagggctctgggttgccagactactcac
tccaaccatgaggtgctgcaaaactgcccacttgtcatctttgccaccaaaccccaagtc
ctgccaactgtcctggcggaagtggcccccatagtcaccactgagcacatcatcgtatct
gtggctgctgggatctctctgagcacaatggaggggctgttacccccgaacacacgagta
ttgcgagtctctcccaatctaccctgcgttgtccaggagggggccatggtgatggcccgg
ggccaccatgctgggaacgatgacgcagagctcctacagaacttgctggaagcctgtggg
cagtgcatagaggttcccgagtcctacgtagatatccacaccggtctcagtggcagtggt
gtggcctttgtgtgtacattttcagaggccctggctgaaggtgccatcaaaatgggcatg
cccagtggcctggcccaccgcattgctgctcagaccctgctggggacagccaagatgctg
cagcaggaagggaagcacccagcccagcttcggacagatgtgctcacaccagctggaacc
accatccatgggttgcatgccctagagcggggcggttttcgagcggctaccatgagtgcg
gtggaagcagctacctgccgggctaaggagctcagcaagaagtaa

DBGET integrated database retrieval system