KEGG   Mus musculus (mouse): 66197Help
Entry
66197             CDS       T01002                                 

Gene name
Cks2, 1110038L14Rik, CKSHS2
Definition
(RefSeq) CDC28 protein kinase regulatory subunit 2
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    66197 (Cks2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    66197 (Cks2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CKS Peptidase_M29
Motif
Other DBs
NCBI-GeneID: 66197
NCBI-ProteinID: NP_079691
MGI: 1913447
Ensembl: ENSMUSG00000062248
Vega: OTTMUSG00000023833
UniProt: P56390 Q545R9
Position
13; 13 A5
AA seq 79 aa AA seqDB search
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
EPEPHILLFRRPLPKEQQK
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaagcagatctactactcagacaagtacttcgatgagcactacgagtaccgg
catgtcatgttacccagagaactctctaaacaagtacccaaaactcatctgatgtccgaa
gaggagtggaggagacttggtgtccaacagagtctaggatgggttcattacatgattcat
gagccagaaccgcatattcttctctttagacgacctcttccaaaagaacaacaaaaatga

DBGET integrated database retrieval system