KEGG   Mus musculus (mouse): 66218Help
Entry
66218             CDS       T01002                                 

Gene name
Ndufb9, 1190008J14Rik, CI-B22
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66218 (Ndufb9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66218 (Ndufb9)
  09159 Environmental adaptation
   04714 Thermogenesis
    66218 (Ndufb9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66218 (Ndufb9)
   05012 Parkinson disease
    66218 (Ndufb9)
   05016 Huntington disease
    66218 (Ndufb9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    66218 (Ndufb9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N
Motif
Other DBs
NCBI-GeneID: 66218
NCBI-ProteinID: NP_075661
MGI: 1913468
Ensembl: ENSMUSG00000022354
UniProt: Q9CQJ8
Structure
PDB: 

Position
15; 15 D1
AA seq 179 aa AA seqDB search
MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRA
TQLLREAEEEFWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCLDYWHPSEKAMYPDYFS
KREQWKKLRMESWDREVKQLQEETSPDGIMTEALPPARREGDLPPLWWHIVTRPRERPT
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctgcgctcccccggcctacctgacccaccagcagaaggtgctgcggctgtat
aagcgcgcgctgcgccacctcgagtcatggtgtatccacagggacaagtaccggtacttt
gcttgcttgatgagagcccggtttgaagaacataagaatgagaaggatatgatgagggct
acccagctgctgagggaggcagaagaagaattctggcagaatcagcatcctcagccgtat
atcttcccagactctccggggggcacttccttcgagagatatgagtgctacaaggttcca
gaatggtgcttagattactggcatccctctgagaaagcaatgtatcctgattacttttcc
aagagagagcagtggaagaagctgaggatggagagctgggatcgggaggttaagcagctg
caggaggaaacatcacctgatggtattatgactgaagctttgcctcctgccagaagggaa
ggtgacttgcccccactgtggtggcatattgtgaccagacctcgggaacggcccacatag

DBGET integrated database retrieval system