KEGG   Mus musculus (mouse): 66225
Entry
66225             CDS       T01002                                 

Gene name
Llph, 1190005P17Rik
Definition
(RefSeq) LLP homolog, long-term synaptic facilitation (Aplysia)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Laps DUF2423 RRT14 MCLC
Other DBs
NCBI-GeneID: 66225
NCBI-ProteinID: NP_079707
MGI: 1913475
Ensembl: ENSMUSG00000020224
Vega: OTTMUSG00000032589
UniProt: Q9D945
Position
10; 10 D2
AA seq 130 aa
MAKSLRSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVEEIATVVVAKPRQEKM
QCEEGRCDGADEEKDDMKMETEIKRNRKTLLDQHGQYPVWMNQRQRKRLKAKREKKRGKS
RAKAAKGLAW
NT seq 393 nt   +upstreamnt  +downstreamnt
atggctaaaagcctgcggagtaagtggaagaggaagatgcgggccgagaagagaaagaag
aatgcgccaagggagctcaacagactgaagagtatcctcagagtggacggggatgctcta
atgaaagacgttgaggagatagcaaccgtggtggtagccaaacctcgccaggagaaaatg
cagtgtgaggaagggcggtgtgacggcgcagatgaggaaaaggatgacatgaaaatggaa
actgaaattaagagaaacagaaagactcttctagaccagcatggccagtacccagtgtgg
atgaaccagaggcaaagaaaaagactgaaggccaagagagaaaagaaacgagggaaaagc
agagcaaaggccgcgaagggcctggcctggtag

DBGET integrated database retrieval system