KEGG   Mus musculus (mouse): 66240
Entry
66240             CDS       T01002                                 

Gene name
Kcne1l, 1500015C14Rik, Kcne, Kcne5, Mink
Definition
(RefSeq) potassium voltage-gated channel, Isk-related family, member 1-like, pseudogene
  KO
K04895  potassium voltage-gated channel Isk-related subfamily E member 1-like
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    66240 (Kcne1l)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   66240 (Kcne1l)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 66240
NCBI-ProteinID: NP_067462
MGI: 1913490
Ensembl: ENSMUSG00000090122
Vega: OTTMUSG00000018812
UniProt: Q9QZ26
Position
X; X F2
AA seq 143 aa
MNCSESQRLQTLLNRLLLELHHRGNASGLGIGTGPSMGMGVVPDPFVGREATSAKGNDAY
LYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPAAIASADPENGQGL
LAEGGHQLAAGALPALAQGAERV
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaactgcagcgagagccaacggctgcaaaccctcttgaaccgcttgctgctggagctg
caccatcgtggcaacgccagcggcctgggcatcggaaccggcccgagcatgggcatgggg
gtcgtccctgaccctttcgtgggccgcgaggcgaccagcgccaagggtaacgacgcttat
ctctacatcctactcatcatgatcttctatgcctgcctagccggaggcctcatcctggcc
tacacccgctcccgcaagctcgtcgaggccaaggatgagccacccctggcctgtgttgct
gagcaggaatgggtccccgctgccatcgcatctgccgacccggagaatggccagggcttg
ctggctgagggcggccaccagctcgcagcaggggcgctgcctgcgctggctcagggcgct
gagagggtctag

DBGET integrated database retrieval system