KEGG   Mus musculus (mouse): 66249
Entry
66249             CDS       T01002                                 

Gene name
Pno1, 1810003N24Rik, AA407421, AU015468, AU019495, AU042323, Emi, Emi3, Im, Imi3
Definition
(RefSeq) partner of NOB1 homolog
  KO
K11884  RNA-binding protein PNO1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    66249 (Pno1)
   03051 Proteasome [BR:mmu03051]
    66249 (Pno1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    66249 (Pno1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    66249 (Pno1)
SSDB
Motif
Pfam: KH_8 KH_1
Other DBs
NCBI-GeneID: 66249
NCBI-ProteinID: NP_079719
MGI: 1913499
Ensembl: ENSMUSG00000020116
Vega: OTTMUSG00000005193
UniProt: Q9CPS7
Position
11; 11 A2
AA seq 248 aa
METQSTGTEDGFTPVTHRGGRRAKKRQAEQSSAAGQDGEAGRMDTEEARPAKRPVFPPLS
GDQLLTGKEETRKIPVPGNRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKDT
KDVSALTKAADFVKAFVLGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIA
GKGGKTKFTIENVTRTRIVLADVHVHILGSFQNIKMARTAICNLILGNPPSKVYGNIRAV
ASRSADRF
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagacgcaaagcaccggaacggaggacggctttactcccgtcacgcacagagggggc
cgccgggcgaagaaacgacaggctgagcagtcgtcagcggcgggacaggatggagaagcc
ggacgcatggacacggaggaggcgcggccggcgaagaggccggtcttcccgccgctctcc
ggggatcagctcctgactgggaaagaagaaacgaggaaaattcccgtcccaggtaacaga
tacacaccgttgaaagaaaactggatgaagatatttactccgattgtagaacatttggga
cttcagatacgctttaacctgaaatcaaggaatgtagaaatcaggacttgtaaagacacc
aaggatgtcagtgccctgacaaaagcggccgactttgtgaaagcctttgttcttggcttt
caggtggaggatgcacttgcccttatccgactagatgacctcttcctagagtcttttgaa
ataactgatgttaagcccctaaaaggagaccacctgtcaagggcaataggaagaattgct
ggcaaaggaggaaaaaccaaatttaccatagagaacgtaacacggacacggattgtcctg
gcagatgtgcacgttcacattcttggctctttccaaaatatcaagatggcaagaacagct
atttgcaacctcatcctaggaaatcctccatcaaaggtgtatggcaatatccgagctgtg
gccagcagatcagcagatcggttctga

DBGET integrated database retrieval system