KEGG   Mus musculus (mouse): 66272Help
Entry
66272             CDS       T01002                                 

Gene name
Cox16, 1810020G14Rik, 1810055I05Rik, BB388670
Definition
(RefSeq) cytochrome c oxidase assembly protein 16
  KO
K18182  cytochrome c oxidase assembly protein subunit 16
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66272 (Cox16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66272 (Cox16)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    66272 (Cox16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX16 Chitin_synth_1N LRR_5
Motif
Other DBs
NCBI-GeneID: 66272
NCBI-ProteinID: NP_079737
MGI: 1913522
Ensembl: ENSMUSG00000091803
Vega: OTTMUSG00000035308
UniProt: Q9CR63
Position
12; 12 D1
AA seq 106 aa AA seqDB search
MIAPAVLRALRKNKTLRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNK
ITLESEYEKIKDSTFENWKNIRGPRPWEDPQLLQGRNPETLKPKTT
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgcccgctgtgttgcgagctctgcgtaagaacaagactctacgctatggagtt
cccatgttgttgctggttgttggaggttcttttggtcttcgtgaattttcacaaatccgg
tacgatgctgtgacaattaagattgatcctgaattggagaaaaaattgaaagtgaataaa
ataactttagagtcagagtatgagaaaataaaggactccacttttgaaaactggaagaat
attcgaggtccgaggccttgggaagatcctcaactcctccaaggacgaaacccagaaact
cttaagcctaagacaacctga

DBGET integrated database retrieval system