KEGG   Mus musculus (house mouse): 66277
Entry
66277             CDS       T01002                                 
Symbol
Klf15, 1810013I09Rik, AV048136, AW494632, CKLF, KKLF, hlb444
Name
(RefSeq) Kruppel-like factor 15
  KO
K09210  krueppel-like factor 15
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    66277 (Klf15)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    66277 (Klf15)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC DUF5810 zf-met zf-C2H2_9 IFT43 DUF2225 zf-C2H2_8 zf-Di19 zf-C2HC_2
Other DBs
NCBI-GeneID: 66277
NCBI-ProteinID: NP_075673
MGI: 1929988
Ensembl: ENSMUSG00000030087
UniProt: Q9EPW2
Position
6:90437785..90468785
AA seq 415 aa
MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPCSCASPDSQAF
CSCYSAGPGPEAQGSILDFLLSRATLGSGGGSGGIGDSSGPVTWGSWRRASVPVKEEHFC
FPEFLSGDTDDVSRPFQPTLEEIEEFLEENMEAEVKEAPENGSRDLETCSQLSAGSHRSH
LHPESAGRERCTPPPGGTSGGGAQSAGEGPAHDGPVPVLLQIQPVAVKQEAGTGPASPGQ
APESVKVAQLLVNIQGQTFALLPQVVPSSNLNLPSKFVRIAPVPIAAKPIGSGSLGPGPA
GLLVGQKFPKNPAAELLKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWR
FSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRAVRAIN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggtggaccacctgcttccagtggacgagaccttctcgtcaccgaaatgctcagtgggt
tacctaggggacaggctggccagccggcagccataccacatgttgccctcgcccatctcg
gaggatgacagcgatgtctccagcccctgctcttgtgccagccctgactcgcaagccttc
tgttcctgctacagtgcgggtccaggccctgaggcccagggcagcatcttggatttcctc
ctgtcccgggccacactgggcagtggtggtggcagtggaggtattggagatagcagtggc
cctgtgacctggggatcatggaggagagcctctgtgcctgtgaaggaggaacatttctgc
ttccctgaatttctgtcaggggacactgatgacgtctccaggcccttccagcctaccctg
gaggagattgaagaattcctggaagagaacatggaggctgaggtcaaggaggccccagag
aacggtagcagggacctggagacctgtagccagctctcagctgggtcacaccggagccac
cttcatccagagtctgctgggagagagcgctgtaccccaccaccaggtggcacgagtggg
ggtggtgcccaaagtgcaggtgaggggccagcacatgatggccccgtgccggtgctactg
cagatccagcctgttgctgtgaagcaggaggcaggtacagggccagcctccccagggcag
gccccagagagcgtcaaggtcgcccagcttctagtcaacatccaggggcagacctttgca
ctcctgcctcaagtggtaccatcctccaacttgaacctgccctcaaagtttgtgcgaatt
gcgcctgtgcccattgccgccaaacctattggctcaggatccctagggcccggccctgct
ggcctccttgtgggccagaagtttcccaagaacccagcagcagaacttctcaaaatgcac
aaatgcactttcccaggctgcagcaagatgtacaccaagagcagccacctcaaggcccac
ctgcgtcggcacacaggcgagaagccctttgcctgcacctggccaggctgcggctggagg
ttttcccgctcagatgagttgtcaaggcaccggcgatctcactcgggtgtgaagccgtac
cagtgtcccgtgtgcgagaagaaattcgcgcggagtgaccacctctccaaacacatcaaa
gtgcatcgcttcccacgaagcagccgcgcagtacgcgccatcaactga

DBGET integrated database retrieval system