KEGG   Mus musculus (mouse): 66282Help
Entry
66282             CDS       T01002                                 

Gene name
Tma16, 1810029B16Rik
Definition
(RefSeq) translation machinery associated 16
  KO
K14860  translation machinery-associated protein 16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    66282 (Tma16)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    66282 (Tma16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tma16 DUF1910 UCH
Motif
Other DBs
NCBI-GeneID: 66282
NCBI-ProteinID: NP_079741
MGI: 1913532
Ensembl: ENSMUSG00000025591
Vega: OTTMUSG00000030740
UniProt: Q9CR02
Position
8; 8 B3.1
AA seq 221 aa AA seqDB search
MPKGLKGKMVGREKKVIHPYSRKAAQITRESHKQDKKERLKTEKALRLNLIGDKLQWFHS
HLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKDRQGRRHHSREAVIKQTLERE
RQQYEGYGFEIPDILDSNTLQTFREWDFDLKKLPNIKMRKLCADDAVPKKRKQKNILNIE
KDLGELELSGPTGATTDGKLEPASESSDTDEEMTPVPVSPH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaggactaaaaggaaaaatggtaggacgagaaaaaaaagtcatccatccgtac
agtagaaaagcagctcagattacaagagagtctcacaaacaagacaagaaggaaagattg
aagactgagaaggccttgcgtctcaaccttattggtgacaaacttcaatggtttcacagt
catctggatatgaaaaaaacaagatattcaaagaaagatgcctgtgaattagttgaaagg
tacttggatcggttcagcagtgagctggagcagattgagttacagaacagcatcaaagac
aggcagggaaggcggcaccattcccgggaggccgtcatcaagcagaccctggagcgggag
cggcagcagtacgaaggctatggctttgagatcccagacattttagactctaatactctg
cagactttccgggaatgggattttgatctgaagaaattgccaaacatcaaaatgaggaaa
ctttgtgctgatgatgcagttcctaagaagcgcaaacagaaaaatattttaaatatagaa
aaggatttaggagaattagaactatcagggccaactggagccactacagatgggaaactg
gaaccagcaagtgaatcaagtgacacggatgaagaaatgactccagtgcctgtcagccct
cattga

DBGET integrated database retrieval system