KEGG   Mus musculus (house mouse): 66306
Entry
66306             CDS       T01002                                 
Symbol
Fam53c, 2810012G03Rik, Gm21179
Name
(RefSeq) family with sequence similarity 53, member C
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM53
Other DBs
NCBI-GeneID: 66306
NCBI-ProteinID: NP_780313
MGI: 1913556
Ensembl: ENSMUSG00000034300
UniProt: Q8BXQ8
Position
18:34891885..34906813
AA seq 393 aa
MITLITEQLQKQTLDELKCTRFSVSLPLPDHADIPNCGDPFQLVSEGASWRGLPHCSCAE
FQDSLNFSYHPSGLSLHLRPPSRGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRS
LSVPVDLSRWQPVWRPAPSKLWTPIKHRGNAGGGGPQVPQQSPPKRVSSLRFLQAPSASS
QCAPAHRPYSPPFFSLALAQDSAQPCATSPQSGSWESDAESLSPCPPQRRFSLSPSLGPQ
ASRFLPSARSSPASSPELPWRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDCRRLRPSL
DFDKMNQKPYSGGLCLQETAREEGSNVSPPWFMACSPPPLSASCSPVEGSSQVLSESEEE
EEGSVRWERQALSKRTLCQQDFGDLDLNLIEEN
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcaccctgatcacggagcagctccagaagcagaccctggatgagctgaaatgcacg
cgcttcagcgtcagtctgcctttgcctgatcatgcagacatacccaactgtggggaccct
ttccagcttgtgtctgaaggtgcttcctggaggggcctgccccactgttcctgtgctgag
ttccaggacagcctcaacttcagctaccatccctcaggcctaagcctgcacctcagacca
cccagtcggggaaactcccccaaggagccgcccctctcccaagtactgagccccgaaccc
ccagacccagagaagcttcctgtgccccctgcccctccatccaagaggcactgccgctca
ctctcggtgcctgtggacctgtctcgctggcagccggtgtggcggcctgccccctccaag
ctgtggactcccatcaagcaccggggcaatgctggagggggtgggccgcaggtgcctcag
cagagccctccgaagcgggtctccagcctcaggttcctccaagctcccagtgcctcgtct
cagtgtgccccagcccacagaccctacagccctcctttcttcagcctggccctggcccaa
gattccgctcagccctgcgccacctcccctcagagtggctcctgggagagtgatgcagag
tccctgtcgccctgcccaccccagcgccgcttctccctgtcacccagcctgggcccacag
gcgagccgcttcctgccctctgcccggagctctcccgcgtcttccccagagctgccctgg
agaccccgaggtctccgaaaccttccccgaagccgctcacagccttgtgatctggatgcc
cgcaaaactggtgtcaagcggcgtcatgaggaagactgcaggcgccttcggccttccttg
gactttgacaagatgaatcagaaaccatactcaggaggtctctgtctccaagaaacagcc
cgagaagaaggcagcaacgtctctccaccatggttcatggcctgtagtcccccacctctc
tctgcttcctgcagtcccgtcgagggttcatcccaggtgctgagtgaaagcgaagaggag
gaagaggggtctgtgcggtgggaacggcaggcactgagcaagcggacattgtgccagcag
gactttggggacctggacctgaatctgattgaagaaaactaa

DBGET integrated database retrieval system